SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000087 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000087
Domain Number 1 Region: 5377-5535
Classification Level Classification E-value
Superfamily SET domain 9.42e-49
Family Histone lysine methyltransferases 0.0065
Further Details:      
 
Domain Number 2 Region: 1402-1462
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000000509
Family PHD domain 0.0039
Further Details:      
 
Domain Number 3 Region: 272-326
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000000000532
Family PHD domain 0.0022
Further Details:      
 
Domain Number 4 Region: 1477-1545
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000113
Family PHD domain 0.025
Further Details:      
 
Domain Number 5 Region: 1356-1410
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000117
Family PHD domain 0.017
Further Details:      
 
Domain Number 6 Region: 224-277
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.000000249
Family PHD domain 0.01
Further Details:      
 
Domain Number 7 Region: 2004-2054
Classification Level Classification E-value
Superfamily HMG-box 0.00000293
Family HMG-box 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000087   Gene: ENSFCAG00000000093   Transcript: ENSFCAT00000000094
Sequence length 5535
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:78500669:78532730:-1 gene:ENSFCAG00000000093 transcript:ENSFCAT00000000094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSQKPPGEDKDSEPAADGPAASEESGTTEPDLPNPHVGEVSVPSSGGPRLQEPPQDCSG
GPVRRCALCNCGEPSLHGQRELRRFELPFDWPQCPVASPGGNPGPNEAALPCEDLSQIGF
PEGLTPAHLGEPGGSCWAHHWCAAWSAGVWGQEGPELCGVDKAIFSGISQRCSHCTRRGA
SIPCRSPGCPRLYHFPCATASGSFLSMKTLQLLCPEHSEGAAHLEEARCAVCEGPGELCD
LFFCTSCGHHYHGACLDTALTARKRAGWQCPECKVCQACRKPGNDSKMLVCETCDKGYHT
FCLKPPMEELPAHSWKCKACRVCRACGAGSAELNPNSEWFENYSLCHRCHKAQGGQPVSS
VAEQHPPVCSRFSPPEPGDTPTDEPEALYVACQGQPKGGHVTSMQPKEPGPLQCEAKPLG
RAGAQLEPQLEAPLNEEMPLLPPPEESPLSPPPEESPTSPPPEASRLSPPPEESPLSPPP
EESPLSPPPESSPFSPLEESPFSPPEESPPSPPLETPLSPPPEASPLSPPFEESPLSPPP
EELPTSPPPEASRLSPPPEESPMSPPPEESPMSPPPEASRLFPPFEESPLSPPPEESPLS
PPPEASRLSPPPEDSPMSPPPEDSPMSPPPEVSCLSPLPEVSRLSPPPEESPLSPPPEES
PTSPPPEASRLFPPPEDSPASPPPEDSPASPPPEELLMTLPLEESSLLPLPEEPRLCPRP
EEPRLSPRPEEPCLSPRPEEPRLSPALEEPRLSPAPEEPCLSPRPEEPRLSPRPEEPRLS
PQPEEPCLSPLPEEPQLSPVPEELRLSPGPEEPRLSPQPEEPPLSPRPEELRLSPQPEEP
RLSPRPEEPPEEPGLCPAAEELPLFLPPGEPPLSPLLGEPALSEPGEPPLSPLPEELPLS
PSGEPSLSPQLMPPDPLPPPLSPIITAVAPPALSPLGELEYPFGAKGDSDPESPLAAPIL
ETPISPPPEANCTDPEPVPPMILPPSPGSPMGPASPILMEPLPPQCSPLLQHSLPPQNSP
PSQCSPPALPLSIPSPLSPMEKAVEVSDEAEPHEMETEKVPEPECPALEPSPTSPLPSPM
GNLSCPAPSPAPALDDFSGLGEDTAPLDGTDTPGSQPEAGQTPGSLASELKGSPVLLDPE
ELAPVTPMEVYGPECKQAGQSSPCEEQEEPRAPVAPTPPTLIKSDIVNEISNLSQGDASA
SFPGSEPLLGSPDPEGGGSLSMELGVSTDVSPARDEGSLRLCTDSLPETDDSLLCDAGTA
IGGGKAEGDKGRRRSSPARSRIKQGRSSSFPGRRRPRGGAHGGRGRGRARLKSTTSSIET
LVVADIDSSPSKEEEDDDDDTMQNTVVLFSNTDKFVLMQDMCVVCGSFGRGAEGHLLACS
QCSQCYHPYCVNSKITKVMLLKGWRCVECIVCEVCGQASDPSRLLLCDDCDISYHTYCLD
PPLLTVPKGGWKCKWCVSCMQCGAASPGFHCEWQNSYTHCGPCASLVTCPICHAPYVEED
LLIQCRHCERWMHAGCESLFTEDDVEQAADEGFDCVSCQPYVVKPAAPVAPPELVPMKVK
EPEPQYFRFEGVWLTETGMAVLRNLTMSPLHKRRQRRGRLGLPGEAGLEGSEPSDALGPD
DKKDGDLDADELLKGEGGVEHMECEMKLEGPVSPDIEPGREETEESKKRKRKPYRPGIGG
FMVRQRKSHTRVKKGPAAQAEVLSGDGQPDEVMPADLPAEGPVDQSLADGDEKKKQQRRG
RKKSKLEDMFPAYLQEAFFGKELLDLSRKALFAVGVGRPSFGLGAPKAKGDSGSDRKELP
TSQKGDDAPDVADEESRGLEGKADTPGPEDGGIKASPVPSDPEKPGTPGEGMLSSDLDRI
PTEELPKMESKDLQQLFKDVLGSEREQHLGCGTPGSDGSRTPLQRPFLQGGLPLGNLPSS
SPMDSYPGLCQSPFLDSRERGGFFSPEPGEPDSPWTGSGGTTPSTPTTPTTEGEGDGLSY
NQRSLQRWEKDEELGQLSTISPVLYANINFPNLKQDYPDWSSRCKQIMKLWRKVPATDKA
PYLQKAKDNRAAHRINKVQKQAESQINKQTKVGDMARKTDRPALHLRIPPQPGALGSPPP
AAAPTIFIGSPTTPAGLSTSADGFLKPPAGTVPGPDSPGELFLKLPPQVPAQVPSQDPFG
LAPAYALEPRFPTAPPTYPPYPSPTGAPAQPLTLGASSRPGTGQPGEFHTTPPGTPRHQP
STPDPFLKPRCPSLDNLAVPESPGIGGGKAAEPLLSPPPFGESRKALEVKKEELGASSPS
YGPPNLGFVDSPSSGPHLGNLELKAPDVFKAPLTPRASQVEPQSPGLGLRPQEPPPAQAL
APSSPSHSDIFRPGPYPDPYAQPPLTPRPQPPPPESCCALPPRSLPSDPFSRVPASPQSQ
SSSQSPLTPRPLSAEAFCPSPVTPRFQSPDPYSRPPSRPQSRDPFAPLHKPPRPQPPEVA
FKAGPLAHTPLGAGGFPAALPSGPAGELHAKVPSGQPPNFARSPGTGAFVGTPSPMRFTF
PQAVGEPSLKPPVPQPGLPPPHGINSHFGPGPTLGKPQSTNYAVATGNFHPSGSPLGSSS
GSTGEGFGLSPLRPPSVLPPPAPDGSLPYLSHGASQRAGITSPVDKREDPGAGLGSSLAA
PELPGTQDPGMSSLSQTELEKQRQRQRLRELLIRQQIQRNTLRQEKETAAAAAGAVGPPG
SWGAEPSSPAFEQLNRGQTPFAGTQDKSSLVGLPPSKLGGPIMGPGAFPSDDRLSRPPPP
ATPSSMDVSSRQLVGGSQAFYQRAPYPGSLPLQQQQQQQQQQLWQQQQQQQQATATSMRL
AMSTRFPSTPGPELGRQTLASPLAGIPARLPGPGEPVPGPAGPAQFIELRHNVQKGLGPG
GAPFPGQGPPQRPRFYPVSEDSHRMAPEGLRGLAVSGLPPQKPAAPPAPELNSSLHPVPH
TKGPSLPTGLELVSRPTSNTELGRPPPLALEAGKLPCEDPELDDDFDAHKALEDDEELAH
LGLGVDVAKGDDELGTLENLETNDPHLDDLLNGDEFDLLAYTDPELDTGDKKDIFNEHLR
LVESANEKAEREALLRGVEPGPMGPDERPLPAADVSEARLASVLPEVKPKVEEGGRHPSP
CQFAITTPKVEPAPATTSLGLGLKPGQSVMGTRDTRMGTGPFSGSGHTTEKGPFGATGGP
PAHLLTPSPLSGPGGSSLLEKFELESGALTLPGGHAASGDELDKMESSLVASELPLLIED
LLEHEKKELQKKQQLSAQLQPAQQQQQQQQQQQQQQHSLLATPGPAQAMSLTHEGSSPSL
AGPQQQLALGLGGSRQPGLAQPLMPTQPPAHALQQRLAPSMTMVSSQGHMLSGQHGGQAG
LVPQQSPQPVLAQKPMGTMPPSMCMKPQQLAMQQQLANSFFPDTDLDKFAAEDIIDPIAK
AKMVALKGIKKVMAQGSIGVAPGMNRQQVSLLAQRLSGGPGSDLQNHVAAGSGQERSAGD
PSQPRPNPPTFAQGVINEADQRQYEEWLFHTQQLLQMQLKVLEEQIGVHRKSRKALCAKQ
RTAKKAGREFPEADAEKLKLVTEQQSKIQKQLDQVRKQQKEHTNLMAEYRNKQQQQQQQQ
QQQHSAVLALSPSQSPRLLTKLPGQLIPGHGLQPPQGPPGGQAAGLRLPPGGMALPGQPG
GPFLNTSLAQQQQQQHSGGTGALAGPSGGFFPGNLALRGLGPDSRLLQERQLQLQQQRMQ
LAQKLQQQQQQQHLLGQVAIQQQQQQSLGVQANQALGPKPPGLLPPSSHQGLLVQQLSPQ
PPQGPQGMLGPAQVAVLQQQQQQHPGALGPQGPHRQVLLTQSRVLSSPQLAQQGQGLMGH
RLVTAQQQQQQQHQQQGSMAGLSHLQQGLMPHSGQPKLSAQPMASLQQQQLQQQQLQQQQ
QQQQQLQQQQQQQQQQLQQQQQQLQQQQLQQQQQLQQQQLQQQQLQQQQQQQQQLQQQQQ
QQQQQQQQQQMGLLNQSRTLLSPQQQQQQQVTLGPGIPAKPVQHFSNPGTLGPTVLLTGK
EQSIVETALPPEATEGPSTHQGGPLAIGTIPESVATEPGEVKPSLSGDSQLLLVQPQAQP
QPNPVQLQPPLRVPGQQQQQVNLLHTGGVGSHGQAGSGSSSEASSMPHLLAQSSVPLGEQ
PGTMTQNLLGSQQPLGLERPVQNNAGPQPAKSGPVPQAGQGLPGAGVMPTVGQLRAQLQG
VLAKNPQLRHLSPQQQQQLQALLMQRQLQQSQSVRHAPPYQEPGAQPSPLQGLLGRQPQL
GGFPGSQTGPLQELGAGLRPQGPPRLPTPQGALSTGPVIGPVHPTPPPSSPQEPKRPSSQ
PPGASPLVPSQLPSEAQLTPTQPGTPKPQGPSLELPPGRVSPAAAQLADTFFGKGLGPWD
PPDNLVEAQKPEQSIHLEQVNGQAVPEPPHLSIKQEPREEPCALGAQAVKREANGEPIGA
PGTSNHLLLAGPRSEAGHLLLQKLLRAKNVQLSTGRGPEGLRAEINGHIDSKLAGLEQKL
QGTPSNKEDTAARKPLTPKPKRVQKTSDRLVSSRKKLRKEDGVRASEALLKQLKQELSLL
PLTEPTITANFSLFAPFGSGCPVNGQCQLRGAFGSGALSTGPDYYSQLLTKNNLSNPPTP
PSSLPPTPPPSVQQKMVNGVTPSEELGEHPKDAASARDTEGTLRDTSEVKSLDLLAALPT
PPHNQTEDVRMESDEDSDSPDSIVPASSPESILGEEAPRFPQLGSGRWEQDDRALSPVIP
IIPRASIPVFPDTKPYGALDLEAPGKLPATTWEKGKGSEVSVMLTVSAAAAKNLNGVMVA
VAELLSMKIPNSYEVLFPESPARAGIEPKKGEAEGPGGKEKGLGGKSPEAGPDWLKQFDA
VLPGYTLKSQLDILSLLKQESPAPEPPTQHSYTYNVSNLDVRQLSAPPPEEPSPPPSPLA
PSPASPPAEPLAELPAEPSAEPPVPSPLPLASSPESARPKPRARPPEEGEDSRPPRLKKW
KGVRWKRLRLLLTIQKAGGRQEDEREVAEFMEQLGTALRPDKVPRDMRRCCFCHEEGDGA
TDGPARLLNLDLDLWVHLNCALWSTEVYETQGGALMNVEVALHRGLLTKCSLCQRTGATS
SCNRMRCPNVYHFACAIRAKCMFFKDKTMLCPMHKIKGPCEQELSSFAVFRRVYIERDEV
KQIASIIQRGERLHMFRVGGLVFHAIGQLLPHQMADFHSATALYPVGYEATRIYWSLRTN
NRRCCYRCSIGENNGRPEFIIKVIEQGLEDLVFTDASPQAVWNRIIEPVAAMRKEADMLR
LFPEYLKGEELFGLTVHAVLRIAESLPGVESCQNYLFRYGRHPLMELPLMINPTGCARSE
PKILTHYKRPHTLNSTSMSKAYQSTFTGETNTPYSKQFVHSKSSQYRRLRTEWKNNVYLA
RSRIQGLGLYAAKDLEKHTMVIEYIGTIIRNEVANRREKIYEEQNRGIYMFRINNEHVID
ATLTGGPARYINHSCAPNCVAEVVTFDKEDKIIIISSRRIPKGEELTYDYQFDFEDDQHK
IPCHCGAWNCRKWMN
Download sequence
Identical sequences ENSFCAP00000000087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]