SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000224 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000224
Domain Number 1 Region: 328-619
Classification Level Classification E-value
Superfamily Family A G protein-coupled receptor-like 0.0000000302
Family Rhodopsin-like 0.026
Further Details:      
 
Domain Number 2 Region: 62-101
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000201
Family EGF-type module 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000224   Gene: ENSFCAG00000000243   Transcript: ENSFCAT00000000243
Sequence length 654
Comment pep:novel chromosome:Felis_catus_6.2:A2:5136234:5176174:1 gene:ENSFCAG00000000243 transcript:ENSFCAT00000000243 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSRCLPLLSGLTVLLALSGSHVKNSEGLCPKCPENASCSNSTHCACKDGFQSVSGRKYI
EPHEKCEDIDECETGLAKCKKKSYCRNEIGSYYCSCVPNSVFNFVAGLFKLDYKECYEAT
GEEIQVSRDIQEILMNNGSKDHIAKVATQVLQDMELIVWTEASAFPGKYENSTLGIVYET
KRCNDTSEKTLLEAGNNTMDINCTDAFKGTIGDRSAVALITYQSLGDILNGSFFNDGRGT
QEVKLNSRVTSGTIGMKEKVYLSEPVFLTFQNIQPGGARAKYFCVSWDASEEGGAWSMEG
CSHVDSNDSHTRCKCFHLSSFAVLMALVPKVDPVLTMITYVGLSLSLLCLLLAALTFLLC
RPIQNTSTFLHLQLSICLFLAHLLFLTGIDQTKPEVLCSIIAGVLHYLYLASFTWMLLEG
LQLFLTVRNLKVANYTSAGKFKKRFMCPFGYGVPALIVAVSAIVRPQNYGTYDRCWLKHD
KAFIWSFMGPVAVIILINLVFYFQILWILRSKLSSLNKEVSTIQDTRVMTFKAIAQLFIL
GCSWGLGYFMVEEFGKVIGSVIAYTFTIINVLQGVLLFVVHCLLNRQVRMEYKKWFSGIW
KAIETESFDVSRSTIQTKMEEPTTSSEFYRRRDAASVQPQPQTLISVLWLKPAN
Download sequence
Identical sequences ENSFCAP00000000224

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]