SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000505 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000505
Domain Number 1 Region: 463-676
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.72e-33
Family Laminin G-like module 0.014
Further Details:      
 
Domain Number 2 Region: 689-891
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.17e-27
Family Laminin G-like module 0.0078
Further Details:      
 
Domain Number 3 Region: 911-1112
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 2.18e-25
Family Laminin G-like module 0.012
Further Details:      
 
Domain Number 4 Region: 224-266
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000000984
Family EGF-type module 0.0078
Further Details:      
 
Domain Number 5 Region: 1297-1337
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000154
Family EGF-type module 0.0037
Further Details:      
 
Domain Number 6 Region: 97-229
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000377
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 7 Region: 1140-1181
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000786
Family EGF-type module 0.0061
Further Details:      
 
Domain Number 8 Region: 304-343
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000134
Family EGF-type module 0.0096
Further Details:      
 
Domain Number 9 Region: 262-300
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000166
Family EGF-type module 0.0047
Further Details:      
 
Domain Number 10 Region: 1176-1218
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000307
Family EGF-type module 0.015
Further Details:      
 
Domain Number 11 Region: 1211-1251
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000383
Family EGF-type module 0.026
Further Details:      
 
Domain Number 12 Region: 67-110
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000799
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 13 Region: 378-482
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000132
Family Growth factor receptor domain 0.011
Further Details:      
 
Domain Number 14 Region: 1264-1301
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000286
Family EGF-type module 0.027
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000000505
Domain Number - Region: 31-58
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0234
Family EGF-type module 0.043
Further Details:      
 
Domain Number - Region: 341-358
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0441
Family EGF-type module 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000505   Gene: ENSFCAG00000000545   Transcript: ENSFCAT00000000545
Sequence length 1406
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F1:35927870:36138801:1 gene:ENSFCAG00000000545 transcript:ENSFCAT00000000545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALKKINYLLIFYLSFSLLTYIRNSSGNKNDTRCLASSCRNNSTCSNTSKDNSCHCSDTA
IDLDKDCDDTEDPCFSNPCQGNATCVNTPGERSFLCKCPPGFSGTTCETAIVFCGTSSCQ
HGGVCHQDPVHPVCICPEGYAGRFCEKGHDPCASSPCHNGAVCQDGMDGYSCFCVPGYQG
RHCELEVDECVSDPCKNEATCLNEIGRYTCICPRDYSGVNCETEVDECWSQPCLNGATCH
DALGAYFCDCPAGFLGDHCELSTDECASQPCLHGGLCIDGHNSYSCNCMDSGFTGTHCET
LMPLCWSKPCHNNATCEDSDDNYTCHCWPGYTGTQCETHINECNSNPCHSGGACVELSSE
KQYGHSAQLPSSFSYPEASGYVCICPPGLTGIHCEEDIDECSSNPCQNGGTCENLPGDYT
CHCPFDNQSGTFYGGRNCSDLFLGCTHHQCLNNGICIPHFQSGQHGFSCLCPSGFTGSLC
EIVTTLSFEGNGFLWITSDPVTAKGFVCNIALKFQTVQPMALLLFRGNGDMFIMLELLSG
YVHLSIQANNQSKVLLYISHNTSDGEWHSVEVMFAEAVTLTLLDNSCKEKCISKAPSPFE
NDQSTCAFQNSFLGGLPVEPSSSGLAPLNIYNIPSTPSFVGCLQDIKIDSNHITPGNISS
GSSLNVKAGCVRKDWCERQPCQNRGRCINLWLNYQCDCYRPYKGLNCLREYVAGRFGQDD
STGYAVFNLDKNYGDNFTISMFVRTHRPSGLLLALENRTYQYIRVWLEHGRLAMLHPGSS
KLVVKFVLSDGNAHLISLKIKPSKIELYQSSRNLGFISAPTWKIQKGDVIYIGGLPDIQE
TEAKGGFFKGCIQDIRLNNQNLEFFPNSTNNASHNPVLVNVTQGCPGDNMCKSNPCHNGG
VCYSLWDDFSCSCPANTAGKACEEVQWCQLSPCPPKAQCQLVPRGFECIANAVFNAQSSE
ILFRSNGNITRELTNITFGFRTRDANVVILHAEKEPGFLNISIQDSRLLFQLQSDNSFYM
LSLKSVQSVNDGIWHQVTLSMTDPLAQASRWQMQVDNQAPFVISAVATGSLNFLKDDTDI
YVGDRAVGNTQGLKGCLSTIEISGIYLSYFENVHGFTNKPQEEQFLKISINSVVTGCLQL
NACNSNPCLHGGNCEDIYSSYHCLCPLGWSGTRCELNIDECFSNPCIHGNCSDRVAAYHC
RCEPGFTGVNCEMDIDNCQSHQCANGATCISDTNGYSCRCFGNFTGKFCRHTRLPSTVCG
NEKTNLTCYSGGNCSEFQGELKCLCPPGFTGEWCEKDIDECASDPCFNGGLCQDLVNRFQ
CLCDVAFAGERCEVDLADDLVSDIFTAVGSVTSALLLILFLAVVASVIASNKRATQGTYS
PSRQEKEGSRVEMWSMMPPPAVERLI
Download sequence
Identical sequences ENSFCAP00000000505 XP_019677489.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]