SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000773 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000773
Domain Number 1 Region: 14-229
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.27e-82
Family Calponin-homology domain, CH-domain 0.0000196
Further Details:      
 
Domain Number 2 Region: 247-369
Classification Level Classification E-value
Superfamily Spectrin repeat 5.76e-34
Family Spectrin repeat 0.000000618
Further Details:      
 
Domain Number 3 Region: 483-604
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-31
Family Spectrin repeat 0.0000035
Further Details:      
 
Domain Number 4 Region: 370-478
Classification Level Classification E-value
Superfamily Spectrin repeat 5.63e-27
Family Spectrin repeat 0.0000029
Further Details:      
 
Domain Number 5 Region: 607-719
Classification Level Classification E-value
Superfamily Spectrin repeat 9.21e-23
Family Spectrin repeat 0.00000225
Further Details:      
 
Domain Number 6 Region: 718-837
Classification Level Classification E-value
Superfamily EF-hand 1.34e-21
Family Calmodulin-like 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000773   Gene: ENSFCAG00000000832   Transcript: ENSFCAT00000000832
Sequence length 872
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B3:116046990:116110181:-1 gene:ENSFCAG00000000832 transcript:ENSFCAT00000000832 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEKVGDEERWGDRKETFTAWCNSHLRKAGTQIENIEEDFRDGLKLMLLLEVISGERLAKP
ERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRFAIQDIS
VEETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALIHRHRPELIDYGKLRKDD
PLTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVSSFYHAFSGAQKAETAAN
RICKVLAVNQENEQLMEDYEKLASDLLEWIRRTIPWLENRAPENTMHAMQQKLEDFRDYR
RLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGRMVSDINNAWGCLEQAEKGYEE
WLLNEIRRLERLDHLAEKFRQKASIHEAWTDGKEAMLRQKDYETATLSEIKALLKKHEAF
ESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQKICDQWDNLGALTQKRREALERT
EKLLETIDQLYLEYAKRAAPFNNWMEGAMEDLQDTFIVHTIEEIQGLTTAHEQFKATLPD
ADKERLAILGIHNEVSKIVQTYHVNMAGTNPYTTITPQEINSKWDHVRQLVPRRDQALTE
EHARQQHNERLRKQFAAQANVIGPWIQTKMEEIGRISIEMHGTLEDQLSHLRQYEKSIVN
YKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDA
KGISQEQMNEFRASFNHFDRDHSGTLGPEEFKACLISLGYDIGNDPQGEAEFARIMSIVD
PNRLGVVTFQAFIDFMSRETADTDTADQVMASFKILAGDKNYITVDELRRELPPDQAEYC
IARMAPYTGPDAVPGALDYMSFSTALYGESDL
Download sequence
Identical sequences A0A2I2U7M8
ENSFCAP00000000773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]