SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000800 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000800
Domain Number 1 Region: 29-77
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000000445
Family Elafin-like 0.0021
Further Details:      
 
Domain Number 2 Region: 83-130
Classification Level Classification E-value
Superfamily Elafin-like 0.000000000458
Family Elafin-like 0.00096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000800   Gene: ENSFCAG00000000859   Transcript: ENSFCAT00000000859
Sequence length 133
Comment pep:novel chromosome:Felis_catus_6.2:A3:15478703:15480299:-1 gene:ENSFCAG00000000859 transcript:ENSFCAT00000000859 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPSSPITFTVLLALEILTPWTAEGTSTEKVKSGACPFRPHGLCLVYEPHECLNDWECPK
DQKCCPSICSNKCLDPVDPSEQVKVNPGRCPLVIGECKEPNPLDTCLNDRDCLTGLKCCK
GPCGNSCVEPLKG
Download sequence
Identical sequences ENSFCAP00000000800

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]