SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000000849 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000000849
Domain Number 1 Region: 1776-2021
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.59e-54
Family Ankyrin repeat 0.0000000622
Further Details:      
 
Domain Number 2 Region: 799-929
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000000628
Family Growth factor receptor domain 0.0072
Further Details:      
 
Domain Number 3 Region: 1113-1253
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000118
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 4 Region: 571-700
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000199
Family Growth factor receptor domain 0.0097
Further Details:      
 
Domain Number 5 Region: 389-512
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000188
Family Growth factor receptor domain 0.014
Further Details:      
 
Domain Number 6 Region: 508-551
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000032
Family EGF-type module 0.0059
Further Details:      
 
Domain Number 7 Region: 185-320
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000033
Family Growth factor receptor domain 0.01
Further Details:      
 
Domain Number 8 Region: 926-1043
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000408
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 9 Region: 1087-1126
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000768
Family EGF-type module 0.01
Further Details:      
 
Domain Number 10 Region: 1251-1303
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000925
Family EGF-type module 0.011
Further Details:      
 
Domain Number 11 Region: 123-164
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000108
Family EGF-type module 0.011
Further Details:      
 
Domain Number 12 Region: 159-196
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000703
Family EGF-type module 0.0021
Further Details:      
 
Domain Number 13 Region: 1464-1497
Classification Level Classification E-value
Superfamily Notch domain 0.0000000798
Family Notch domain 0.0035
Further Details:      
 
Domain Number 14 Region: 1335-1371
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000859
Family EGF-type module 0.021
Further Details:      
 
Domain Number 15 Region: 736-772
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.01
Further Details:      
 
Domain Number 16 Region: 44-80
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.032
Further Details:      
 
Domain Number 17 Region: 312-352
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000196
Family EGF-type module 0.0081
Further Details:      
 
Domain Number 18 Region: 354-396
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000339
Family EGF-type module 0.017
Further Details:      
 
Domain Number 19 Region: 1383-1415
Classification Level Classification E-value
Superfamily Notch domain 0.000000968
Family Notch domain 0.0013
Further Details:      
 
Domain Number 20 Region: 1423-1455
Classification Level Classification E-value
Superfamily Notch domain 0.00000119
Family Notch domain 0.0059
Further Details:      
 
Domain Number 21 Region: 1051-1091
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000286
Family EGF-type module 0.031
Further Details:      
 
Domain Number 22 Region: 692-733
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000082
Family EGF-type module 0.011
Further Details:      
 
Domain Number 23 Region: 774-811
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000879
Family EGF-type module 0.031
Further Details:      
 
Domain Number 24 Region: 82-121
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000017
Family EGF-type module 0.014
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000000849
Domain Number - Region: 1295-1322
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0268
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000000849   Gene: ENSFCAG00000000914   Transcript: ENSFCAT00000000914
Sequence length 2318
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:10996746:11033441:-1 gene:ENSFCAG00000000914 transcript:ENSFCAT00000000914 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLPAAKLPWGTAWPLSPPPHGGPCDPWALPLLLLLAGPGAAAPPCLDGSPCMNGGRCTQL
PSREAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGAARFSCRCPRGFRGPDCS
LPDPCLSSPCAHGARCSGPDGRYLCSCPPGYQGRSCRSDVDECRVGGPCRHGGTCLNTPG
SFRCQCPAGYTGPLCENAAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDD
CPGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHS
CVCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNP
CHEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQC
GRGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDVDECQSSPCV
NGGVCKDRVNGFSCTCPSGFSGAMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEG
TLCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLD
LVDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEIN
ECASSPCGDGGSCVDGENGFRCLCPPGSLPPLCLPTSHPCAQEPCSHGVCHDAPGGFRCM
CEPGWSGPRCSQSLARDACESQPCRSGGTCTSDGIGFHCTCPPGVQGRQCELPSPCTPNP
CEHGGHCESAPGQLPVCSCPPGWQGPRCQQDVDECAGPSPCGSHGTCTNLAGSFSCTCHE
GYSGPSCDQDIDDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSSPCGPG
TCADHVASFTCTCPPGYGGFRCEQDLPDCSPSSCFHGGTCVDGVNSFSCQCRPGFTGAHC
QHEADPCVSRPCLHGGVCTAARPGFRCTCPEGFTGAQCQTLVDWCSHAPCQNGGRCARSG
ASFYCLCPPGWSGRVCDIRSVPCREAAAQIGVRLEELCQTGGQCVDKDNSHYCVCPEGRT
GSHCEQEVDPCLAQPCQHGGTCRGYMGGYVCECPAGYTGDDCEDDVDECASQPCQNGGFC
IDLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDQGPRCLHNGTCVDLVGGFRCTCPPGY
TGLRCEADINECHPGACHDAHTRDCLQDPGGGFRCLCHGGFTGPRCQTVLSPCESQPCQH
GGQCRPSPGPGGALTFTCRCVPPFWGPRCERVARTCAGVPCQQTVRGPRCACPPGLSGPA
CRGSRGSPPGAANASCLASPCLHGGSCGPAPLAPFFRCACAPGWDGPRCEVPAAAPEAPE
EPLCPSAACEAKSGDKRCDRECNSPGCGWDGGDCSLSVGDPWRQCAALQCWRLFNNSRCD
PACSSPACLYDNFDCRAGGRERACNPVYEKYCADHFADGRCDQGCNTEECGWDGLDCAGE
VPALLARGVLVLTVLLPPEELLRSSADFLQRLSGILRTSLRFRLDEHGQAMVFPYHRPGP
GAESRNRRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVERLDFP
YPLRAVRGEPLELPEPSMPLLPLLAASAVFLLAILVLGVMVARRKREHSTLWFPEGFALH
KDVAAGHKGRREPVGQDALGMKNMAKSESLMGQVATDWMDTECPEAKRLKVEDPGVGAED
AVDCRQWTQHHLVAADIRVAPAMALTPPQGDVDADGVDVNVRGPDGFTPLMLASFCGGAL
EPMPTEEDEAEDASASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRLLDAGA
DTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAVEGMVE
ELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFLAAREG
SYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHGLGPLL
CPPGAFLPGLKVAQSGGKKSRRPPGKAGLGPQGARGRGKKLTLACPGPLAESSVTLSPVD
SLDSPRPFGGPPASPGGFSLEGPYAAATATAVSLAQLGGAGRAGLGRQPPGGCVLSLGLL
NPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLVAPGHGEEYPA
AGAHGSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATGPAATA
AGALPAQPLPLSVPGPLAQAQTQLGPQPEVTPKRQVLA
Download sequence
Identical sequences ENSFCAP00000000849

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]