SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001106 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001106
Domain Number 1 Region: 176-379
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.58e-50
Family DBL homology domain (DH-domain) 0.000000467
Further Details:      
 
Domain Number 2 Region: 2-213
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.57e-33
Family Calponin-homology domain, CH-domain 0.0056
Further Details:      
 
Domain Number 3 Region: 366-528
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 4 Region: 654-755,804-830
Classification Level Classification E-value
Superfamily SH2 domain 2.99e-27
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 5 Region: 576-684
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000063
Family SH3-domain 0.0027
Further Details:      
 
Domain Number 6 Region: 770-819
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000144
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001106   Gene: ENSFCAG00000001191   Transcript: ENSFCAT00000001192
Sequence length 834
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:90572487:90923662:-1 gene:ENSFCAG00000001191 transcript:ENSFCAT00000001192 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HCKVLPANHRVTWDSAQVFDLAQTLRDGVLLCQLLNNLRAHSINLKEINLRPQMSQFLCL
KNIRTFLTACCETFGMRKSELFEAFDLFDVRDFGKVIETLSRLSRTPIALATGIRPFPTE
ESVNDEDIYKGLPDLIDETHVEDEEGLYDCVYGEDEGGEVYEDLMKAEEAHQAKCPENDI
RSCCLAEIKQTEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPELVKVHRNLMQEI
HDSIVNKNDQNLYQVFIXXXXXLVIYGQYCSGVELAISSLDNISKTKEDVKLKLEECSKR
ANNGKFTLRDLLVVPMQRVLKYHLLLQELVKHTTDPMEKANLKLALDAMKDLAQYVNEVK
RDNETLREIKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQERHIFLFDLAVIVC
KRKGDNYEMKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKK
WLEQFEMALSNIRPDYADSNFHEFKMHTFSRVTSCKVCQMLLRGTFYQGYLCFKCGARAH
KECLGRVDNCGRVNSAEQGTLKPPEKRTNGLRRNPRQVDPGLPKMQVIKNYTGTPPPALH
EGPPLHIQAGDTVELLRGDAHSLFWQGNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWY
AGAMERLQAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAEN
RKFKSLMELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGHSLLSPKVLGIA
VARYDFCARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE
Download sequence
Identical sequences ENSFCAP00000001106

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]