SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000001742 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000001742
Domain Number 1 Region: 25-66
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000379
Family Elafin-like 0.0017
Further Details:      
 
Domain Number 2 Region: 167-207
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000379
Family Elafin-like 0.0015
Further Details:      
 
Domain Number 3 Region: 73-115
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000602
Family Elafin-like 0.0019
Further Details:      
 
Domain Number 4 Region: 122-160
Classification Level Classification E-value
Superfamily Elafin-like 0.00000405
Family Elafin-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000001742   Gene: ENSFCAG00000001883   Transcript: ENSFCAT00000001883
Sequence length 233
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:15070944:15083891:1 gene:ENSFCAG00000001883 transcript:ENSFCAT00000001883 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VMLSCLFLLKAFLALGSLISWVASGEHVKEGECPPNKNLCKELCWGDESCPAGQKCCSNG
CGRVCRGGIPKGRKGDCPRAVRKQSCFQRCVTDETCPGRKKCCAFGCSKSCVVPVSQPKL
AEPGGECPADPLPCKELCDGDVSCPQGLKCCSTGCGHSCRGDIKGGRSGDCPNILVGLCI
VSCMTDENCQAGEKCCKSGCGRFCVPPILRAELATNPSWTLRSDSELGEYSLS
Download sequence
Identical sequences ENSFCAP00000001742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]