SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002441 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002441
Domain Number 1 Region: 781-874
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-23
Family I set domains 0.016
Further Details:      
 
Domain Number 2 Region: 1069-1163
Classification Level Classification E-value
Superfamily Immunoglobulin 4.56e-23
Family I set domains 0.0036
Further Details:      
 
Domain Number 3 Region: 877-971
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-22
Family I set domains 0.005
Further Details:      
 
Domain Number 4 Region: 1165-1252
Classification Level Classification E-value
Superfamily Immunoglobulin 6.92e-19
Family I set domains 0.0062
Further Details:      
 
Domain Number 5 Region: 132-226
Classification Level Classification E-value
Superfamily Immunoglobulin 1.07e-18
Family I set domains 0.01
Further Details:      
 
Domain Number 6 Region: 421-508
Classification Level Classification E-value
Superfamily Immunoglobulin 1.38e-18
Family I set domains 0.015
Further Details:      
 
Domain Number 7 Region: 973-1067
Classification Level Classification E-value
Superfamily Immunoglobulin 3.62e-18
Family I set domains 0.0025
Further Details:      
 
Domain Number 8 Region: 323-418
Classification Level Classification E-value
Superfamily Immunoglobulin 3.31e-17
Family I set domains 0.028
Further Details:      
 
Domain Number 9 Region: 687-778
Classification Level Classification E-value
Superfamily Immunoglobulin 7.95e-17
Family I set domains 0.0073
Further Details:      
 
Domain Number 10 Region: 227-321
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000147
Family I set domains 0.0084
Further Details:      
 
Domain Number 11 Region: 594-685
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000499
Family I set domains 0.0045
Further Details:      
 
Domain Number 12 Region: 39-128
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000157
Family I set domains 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002441   Gene: ENSFCAG00000002648   Transcript: ENSFCAT00000002652
Sequence length 1341
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:107185867:107199117:-1 gene:ENSFCAG00000002648 transcript:ENSFCAT00000002652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLDRPGQRPTMLRTFTVLLFCIRLSLGMTSIEMTVMQSQPELWIETNYPQAPWENITLW
CKSPSRISSKFLLLKDKTQMTWIRPSSKTFQVSFPLGALTKYNAGLYRCCYWKETGWSEP
SKVLELEAPGQLPKPIFWIQAETSPLPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQIP
TGTVAIFSIANMTPESEGVYICRTHIQMLPTLWSEPSNPLKLIVAGLYPKPTLTAYPGPI
MAPGESLSLRCQGPIYGMTFALIRLEDLEKSFYRKRPIKNEAYFFFRALKIHDAGHYLCF
YYDGSYRGSLLSDILKIWVTDTFPKTWLLAQPSPVVQMGQHMSLWCRGPVDGVGLALYKK
GEDKPLQLLDTASTDDDESFFLNNVTYSDAGVYSCLYLLSWKTSIRMTSHNTMELVVVDK
PPKPSLSAWPSTVFKLGKAITLQCRVPHPVLEFSLEWEERATFQKFSVDGDFIISNAERK
GTGTYSCSYRIEAHPNIWSHRSEPLRLMGPAATGFLTWNYVLNEAIRLSLFMQLVALLLV
VLWIRWKCRRLRIREAWLLGTAQGVTMLFIVTVLFCCGLCNGVLTEETEIIMPTPKPELW
AETNFPLAPWKNLTLWCRSPSGSTKEFVLLKDGTGWIATRPASEQVRAAFPLGALTQSHT
GSYHCHSWEEMAVSEPSEALELVGTDMLPKPVISASPPIRGQKLQIRCKGWLAGMEFVLY
KEGVQEPVQQLGAVGREAFFTIQRMEAKDQGNYSCRTHTEKRPFKWSEPSEPLELVIKEM
YPKPFFKTWASPVVTPGARVTFNCSTPHQHMSFILYKDGSEIASSDRSWASPGASAAHFL
IISVGAGDGGNYSCRYYDFAIWSEPSDPVELVVTEYYPQPTLLAQPGPVVLPGKNVTLRC
QGAFPGMRFALLQEGNQVPLQFQSTSGNSADFLLHTVGAEDSGNYSCVYYETTMSNRGSH
LSKPIMIWVTDTFPKPWLFAEPSSVVPVGKNVTLWCQGPVHGVGYILHKEREATSVQLWG
STSNDGAFPITNISGASIGRYSCCYHPDWTSPIKIQPSNTLELIVTGLLPKPSLLAQPGP
IVAPGENMTFQCQGELPDSTFVLLKEGTQEPLEQQKPSGYRADFWMPAVRGEDSGIYSCV
YYLDSAPFAASNHSDFLEIWVTDKPPKPSLSAWPSTMFKLGKDITLQCRGPLPGVEFVLE
HDGEEAPQQFSEDGDFVINNVEGKGIGNYSCSYRLQAYPDIWSEPSDALELVGAAGPAAQ
ECTVGNIVRSSLIVVVVVALGVVLAIEWKKWPRLRTRDSETDGRDQTIALEECNQEGEPG
ANTSSPSSVSQETSVELPVPI
Download sequence
Identical sequences ENSFCAP00000002441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]