SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000002579 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000002579
Domain Number 1 Region: 110-316
Classification Level Classification E-value
Superfamily Metallo-hydrolase/oxidoreductase 8.12e-19
Family YhfI-like 0.074
Further Details:      
 
Domain Number 2 Region: 19-122
Classification Level Classification E-value
Superfamily ISP domain 0.00000000000000144
Family Ring hydroxylating alpha subunit ISP domain 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000002579   Gene: ENSFCAG00000002804   Transcript: ENSFCAT00000002805
Sequence length 577
Comment pep:known chromosome:Felis_catus_6.2:B2:4587276:4640419:1 gene:ENSFCAG00000002804 transcript:ENSFCAT00000002805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FRSIEQTTEVLLCLSPGEAADLKEGINFLRNKKTGKDFILYKSKNRVRACKNVCKHQGGL
FIKDIEDLDGRSVRCTKHNWRLDVSTMKYVNPPGSFCQDELVVEMDEDNGLLLLELNPPN
PWDSEPRSPEHLAFGEVQITYLTHACMDLKLGDKRMVFDPWLTGPAFARGWWLLHEPPSD
WLERLCQADLIYISHMHSDHLSYPTLKELAGRRPDIPIYVGNTERPVFWNLNQSGVQLTN
INIVPFGIWQQVDKNLRFMILMDGVHPEMDTCIIVEYKGHKILNTVDCTRPNGGRLPEKV
ALMMSDFAGGASGFPMTFSGGKFTEEWKAQFIKAERKKLLNYKARLVKDLQPRIYCPFAG
YFVESHPSDKYIKETNIKNDPNELNNLIKKNSDVVTWTPRPGATLDLSRMLKDPTDSKGI
IEPPEGTKIYKDSWDFEPYLNILNAAVGDEIFLHSSWIKEYFTWAGFKDYNLVVRMIETD
EDFSPFPGGYDYLVDFLDLSFPKERPSREHPYEEIRSRVDVIRHVVKNGLLWDDLYIGFQ
TRLQRSPDIYHHLFWNHFQIKLPLTPPNWRSFLMHCG
Download sequence
Identical sequences ENSFCAP00000002579

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]