SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003330 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003330
Domain Number 1 Region: 596-868
Classification Level Classification E-value
Superfamily Kelch motif 1.7e-67
Family Kelch motif 0.000082
Further Details:      
 
Domain Number 2 Region: 306-429
Classification Level Classification E-value
Superfamily POZ domain 6.28e-27
Family BTB/POZ domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003330   Gene: ENSFCAG00000003613   Transcript: ENSFCAT00000003613
Sequence length 875
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:123699815:123843000:-1 gene:ENSFCAG00000003613 transcript:ENSFCAT00000003613 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRHHSRFERDYRVGWDRREWSANGTHGTTSICSATAGAGGGSASSLSARPGLLPLPVVP
SRLPTPATAPAPCTTGSGEAITSLVASSASAVTTKAPGISKADSQSQGLTTSIRWGQTPI
NQSTPWDTDEPPSKQMRESDNPGTGPWVTTVAAGNQPALIAHSYGVAQPPTFSPAVNVQA
PVIGVTPSLPPHVGPQLPLMPGHYSLPQPPSQPLSSVVVNMPAQALYASPQPLAMSTLPG
VGQVARPGPTAVGNGHMAGPLLPPPAPAQPSATLPSGAPATNGPPTTDSAHGLQMLRTIG
VGKYEFTDPGHPKEMLKELNQQRRAKAFTDLKIVVEGREFEVHQNVLASCSLYFKDLIQR
SVQDGSQCGREKLELVLSNLQADVLELLLEFVYTGSLVIDSANAKTLLEAASKFQFHTFC
KVCVSFLEKQLTASNCLGVLAMAEAMQCSELYHMAKAFALQIFPEVAAQEEILSISKDDF
IAYISNDSLNTKAEELVYETVIKWIKKDPVARAQYAAELLAVVRLPFIHPSYLLNVVDNE
ELIKSSEACRDLVNEAKRYHMLPHARQEMQTPRTRPRLSAGVAEVIVLVGGRQMVGMTQR
SLVAVTCWNPQNNKWYPLASLPFYDREFFSVVSAGDNIYLSGGMESGVTLADVWCYMSLL
DNWNLVSRMTVPRCRHNSLVYDGKIYTLGGLGVAGNVDHVERYDTITNQWEAVAPLPKAV
HSAAATVCGGKIYVFGGVNEAGRAAGVLQSYVPQTNTWSFIESPMIDNKYAPAVTLNGFV
FILGGAYARATTIYDPEKGNIKAGPNMNHSRQFCSAVVLDGKIYATGGIVSSEGPALGNM
EAYEPATNTWTLLPHMPCPVFRHGCVVIKKYIQSG
Download sequence
Identical sequences M3W0N0
XP_006930517.1.62641 XP_006930518.1.62641 XP_019306308.1.44245 XP_019306312.1.44245 ENSFCAP00000003330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]