SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000003358 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000003358
Domain Number 1 Region: 394-496
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.82e-26
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0014
Further Details:      
 
Domain Number 2 Region: 173-227,286-301,329-347
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.00000000000000168
Family BphP N-terminal domain-like 0.051
Further Details:      
 
Domain Number 3 Region: 91-174
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.00000000000000275
Family HLH, helix-loop-helix DNA-binding domain 0.0022
Further Details:      
 
Domain Number 4 Region: 604-767
Classification Level Classification E-value
Superfamily Positive stranded ssRNA viruses 0.000000259
Family Tetraviridae-like VP 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000003358   Gene: ENSFCAG00000003644   Transcript: ENSFCAT00000003644
Sequence length 822
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:103055398:103104599:-1 gene:ENSFCAG00000003644 transcript:ENSFCAT00000003644 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLSSKKIEMTSDVPSLGPAIASGNPGAGIQGGGAIVHRAIKRRSGLDFDDDGEGNSKFL
RCDDDQMSNDKERFARSDDEQSSADKERLARENHSEIERRRRNKMTAYITELSDMVPTCS
ALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFIVS
CETGRVVYVSDSVTPVLNQPQSEWFGSTLYDQVHPDDVDKLREQLSTSENALTELITSCF
CLNFVSPAFPLVQEHTPYCSSFLFSGRILDLKTGTVKKEGQQSSMRMCMGSRRSFICRMR
CGNSSVDPVSMNRLSFVRNRCRNGLGSVKDGEPHFVVVHCTGYIKAWPPAGVSLPDDDPE
AGQGSKFCLVAIGRLQVTSSPNCTDMSNVCQPTEFISRHNIEGIFTFVDHRCVATVGYQP
QELLGKNIVEFCHPEDQQLLRDSFQQVVKLKGQVLSVMFRFRSKNREWLWMRTSSFTFQN
PYSDEIEYIICTNTNVKNSSQEPRPTLSNTIQRPQLGPTANLPLEMGSGQLASRQQQQQT
ELDVVSGRDGLTGYNHSQVSVQPVTTTGPEHSKPLEKSDSLFAQDRDPRFSEIYSNISAD
QSKGISSSTVPATQQLFSQGNTFPPTPRPAENFRNSGLASPVTIVQPSASAGQMLAQISR
HSNPPQGAAPTWTPSTRPGFSAQQVATQATAKTRSSQFGVGSFQTPSSFSPMSLPGASTA
SPGAAAYPSLTNRGSNFAPETGQTTGQFQTRTAEGVSVWPQWQGQQPHHRSSSSEQHVQQ
PSAQQPGQPEVFQEMLSMLGDQSNSYNNEEFPDLTMFPSFSE
Download sequence
Identical sequences ENSFCAP00000003358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]