SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004105 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004105
Domain Number 1 Region: 5-235
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.78e-87
Family Calponin-homology domain, CH-domain 0.0000251
Further Details:      
 
Domain Number 2 Region: 253-375
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-33
Family Spectrin repeat 0.000000295
Further Details:      
 
Domain Number 3 Region: 489-610
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-31
Family Spectrin repeat 0.000000556
Further Details:      
 
Domain Number 4 Region: 376-484
Classification Level Classification E-value
Superfamily Spectrin repeat 2.22e-23
Family Spectrin repeat 0.000000911
Further Details:      
 
Domain Number 5 Region: 614-725
Classification Level Classification E-value
Superfamily Spectrin repeat 1.18e-22
Family Spectrin repeat 0.000000588
Further Details:      
 
Domain Number 6 Region: 718-846
Classification Level Classification E-value
Superfamily EF-hand 4.03e-22
Family EF-hand modules in multidomain proteins 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004105   Gene: ENSFCAG00000004445   Transcript: ENSFCAT00000004449
Sequence length 873
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:11929576:12004307:-1 gene:ENSFCAG00000004445 transcript:ENSFCAT00000004449 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEEEWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISG
ERLPKPDRGKMRFHKIANVNKALDYIASKGVKLVSIGAEEIVDGNVKMTLGMIWTIILRF
AIQDISVEETSAKEGLLLWCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYS
KLNKDDPIGNINLAMEIAEKHLDIPKMLDAEDIVNTPKPDERAIMTYVSCFYHAFAGAEQ
AETAANRICKVLAVNQENERLMEEYERLASELLEWIRRTIPWLENRTPEKAMHAMQQKLE
DFRDYRRKHKPPKVQEKCQLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQA
EKGYEEWLLNEIRRLERVEHLAEKFKQKASTHETWAYGKEQILLQKDYESATLTEVRAML
RKHEAFESDLAAHQDRVEQIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRR
EALERTEKLLETIDQLHLEFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQF
KATLPEADGERQSIMAIQNEVEKVIQSYSIRISSSNPYSTVTVDELRAKWDKVKQLVPIR
DQSLQEELARQHANERLRRQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQY
EHNIINYKNNIDKLEGDHQLIQEALVFDNKHTNYTMEHIRVGWEVLLTTIARTINEVETQ
ILTRDAKGITQEQMNEFRASFNHFDRRKNGLMDHEDFRACLISMGYDLGEAEFARIMTLV
DPNGQGTVTFQSFIDFMTRETADTDTAEQVIASFRILASDKPYILAEELRRELPPDQAQY
CIKRMPAYSGPGSVPGALDYTAFSSALYGESDL
Download sequence
Identical sequences ENSFCAP00000004105

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]