SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004397 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004397
Domain Number 1 Region: 897-966
Classification Level Classification E-value
Superfamily TB module/8-cys domain 7.85e-21
Family TB module/8-cys domain 0.0000687
Further Details:      
 
Domain Number 2 Region: 398-461
Classification Level Classification E-value
Superfamily TB module/8-cys domain 1.01e-17
Family TB module/8-cys domain 0.00046
Further Details:      
 
Domain Number 3 Region: 1110-1161
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000301
Family TB module/8-cys domain 0.0022
Further Details:      
 
Domain Number 4 Region: 272-349
Classification Level Classification E-value
Superfamily TB module/8-cys domain 0.0000000000458
Family TB module/8-cys domain 0.003
Further Details:      
 
Domain Number 5 Region: 347-394
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000375
Family EGF-type module 0.0032
Further Details:      
 
Domain Number 6 Region: 849-895
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000166
Family EGF-type module 0.0075
Further Details:      
 
Domain Number 7 Region: 610-637,687-769
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000408
Family Growth factor receptor domain 0.015
Further Details:      
 
Domain Number 8 Region: 1201-1242
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000618
Family EGF-type module 0.007
Further Details:      
 
Domain Number 9 Region: 978-1026
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000795
Family EGF-type module 0.012
Further Details:      
 
Domain Number 10 Region: 1016-1062
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000123
Family EGF-type module 0.006
Further Details:      
 
Domain Number 11 Region: 1228-1278
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000176
Family EGF-type module 0.01
Further Details:      
 
Domain Number 12 Region: 112-141
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000408
Family EGF-type module 0.035
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000004397
Domain Number - Region: 1067-1100
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0203
Family EGF-type module 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004397   Gene: ENSFCAG00000004757   Transcript: ENSFCAT00000004758
Sequence length 1283
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:110098079:110114433:-1 gene:ENSFCAG00000004757 transcript:ENSFCAT00000004758 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGPRGAAGGLAPEMRGAGAAGLLALLLLLLLLLGPGGGAEGGPAGERGAGGGGALARER
FKVVFAPVICKRTCLKGQCRDSCQQGSNMTLIGENGHSTDTLTGSGFRVVVCPLPCMNGG
QCSSRNQCLCPPDFTGRFCQVPAGGAGGVTGGAGPGLGRAGALSTGALPPLAPESESVAS
KHAIYAVQVIADPPGPGEGPPAQHAAFLVPLGPGQISAEVQAPPPVVNVRVHHPPDASVQ
VHRIEGPNAEGPAPSQHLLPHPKPQHPRPPTQKPLGRCFQDTLPKQPCGSNPLPGLTKQE
DCCGSIGTAWGQSKCHKCPQLQYTGVQKPGPVRGEVGADCPQGYKRLNSTHCQDINECAM
PGMCRHGDCFNNPGSYRCVCPPGHSLGPSRTQCIADKPEEKSLCFRLVSPEHQCQHPLTT
RLTRQLCCCSVGKAWGARCQRCPADGTAAFKEICPAGKGYHILTSHQTLTIQGESDFSLF
LHPDGPPKPQQHPESPSRAPPPEDAEEERGVSTDSPVMEEQSAQQSHLTATTSPARPYPE
LISRPSPPTVRWFLPDLPPSRSAVEIAPTQVTGEPPAPSKSRRLDGLGEEGVMAQAEGGC
PGGLYRLGQCSDSPGGCGNVGCRERYSRQKGQLTRCVWVGQGSGSRPGLQVGGKGEGGGV
LRCPSAWRGGRGPGLQLWAPQSLTHADIDECRDPSSCPDGKCENKPGSFKCIACQPGYRS
QGGGACRADVNECAEGSPCSPGWCENLPGSFRCTCAQGYAPAPDGRSCLGLESARPRAWM
ECGCRAGRRGDLNCLKEPTEEVKRDSSQFSHVQRFGTAQGHGSCLGAFQSCLHPSQHPGS
GDPEAGMACQTDIDECSQDPGLCLPHGACENLQGSYVCVCDEGFTPTQDQHGCEEVEQPH
HKKECYLNFDDTVFCDSVLATNVTQQECCCSLGAGWGDHCEIYPCPVYSSAEFHSLCPDG
KGYTQDNNIVNYGIPAHRDIDECILFGAEICKEGKCVNTQPGYECYCKQGFYYDGNLLEC
VDVDECLDESNCRNGVCENTRGGYRCACTPPAEYSPAQRQCLSPEEMDVDECQDPAACRX
SYRCECRPPWVPGPSGRDCQLPESPAERAPERRDVCWAQRGEDGMCAGPLAGPALTFDDC
CCRQGRGWGAQCRPCPPRSAGSQCPTSQSESNSFWDASPLLLGKPPRGTEEDSSEEDSDE
CRCVSGRCVPRPGGAVCECPGGFQLDASRARCVDIDECRELNQRGLLCKSERCVNTSGSF
RCVCKAGFARSRPHGACVPQRRR
Download sequence
Identical sequences ENSFCAP00000004397

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]