SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000004464 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000004464
Domain Number 1 Region: 304-500
Classification Level Classification E-value
Superfamily Kelch motif 5.89e-59
Family Kelch motif 0.0000155
Further Details:      
 
Domain Number 2 Region: 37-151
Classification Level Classification E-value
Superfamily POZ domain 2.75e-33
Family BTB/POZ domain 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000004464
Domain Number - Region: 477-575
Classification Level Classification E-value
Superfamily C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.0314
Family C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000004464   Gene: ENSFCAG00000004830   Transcript: ENSFCAT00000004831
Sequence length 591
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:44289913:44527037:-1 gene:ENSFCAG00000004830 transcript:ENSFCAT00000004831 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TPSFLYVTCRLSATSHSLTPQSDMDSSSSEEFYQAVHHAEQTFRKMESYLKQQQLCDVIL
IVGNRKIPAHRLVLSSVSDYFAAMFTSDVCEAKQEEIKMEGIDPNALWDLVQFAYTGCLE
LKEDTIENLLAAACLLQLPQVVEVCCHFLMKLLHPSNCLGIRAFADAQGCIELMKVAHSY
TMENIMEVMRNQEFLLLPAEELHKLLASDDVNVPDEETIFHALMMWVKYDMQRRCNDLSM
LLAFIRLPLLPPQILADLENHALFKNDLECQKLILEAMKYHLLPERRTLMQSPRTKPRKS
TVGTLYAVGGMDNNKGATTIEKYDLRTNLWIQAGMMNGRRLQFGVAVIDDKLFVIGGRDG
LKTLNTVECYNPKTKTWTVLPPMSTHRHGLGVTVLEGPIYAVGGHDGWSYLNTVERWDPS
QQWTFVASMSIARSTVGVAALNGKLYSVGGRDGSSCLSSMEYYDPHTNKWNMCAPMCKRR
GGVGVATCDGFLYAVGGHDAPASNHCSRLLDYVERYDPKTDTWTMVAPLSMPRDAVGVCL
LGDRLYAVGGYDGQTYLNTMESYDPQTNEWTQMASLNIGRAGACVVVIKQP
Download sequence
Identical sequences ENSFCAP00000004464

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]