SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005635 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005635
Domain Number 1 Region: 2722-2984
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.6e-70
Family Protein kinases, catalytic subunit 0.00000299
Further Details:      
 
Domain Number 2 Region: 1907-2100
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 3.79e-54
Family DBL homology domain (DH-domain) 0.0000123
Further Details:      
 
Domain Number 3 Region: 1241-1420
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.24e-46
Family DBL homology domain (DH-domain) 0.00000000931
Further Details:      
 
Domain Number 4 Region: 2105-2226
Classification Level Classification E-value
Superfamily PH domain-like 3.22e-33
Family Pleckstrin-homology domain (PH domain) 0.00071
Further Details:      
 
Domain Number 5 Region: 1427-1547
Classification Level Classification E-value
Superfamily PH domain-like 1.02e-32
Family Pleckstrin-homology domain (PH domain) 0.000000801
Further Details:      
 
Domain Number 6 Region: 2615-2711
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-23
Family I set domains 0.0093
Further Details:      
 
Domain Number 7 Region: 258-394
Classification Level Classification E-value
Superfamily Spectrin repeat 4.56e-21
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 8 Region: 1055-1192
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-20
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 9 Region: 805-958
Classification Level Classification E-value
Superfamily Spectrin repeat 5.68e-20
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 479-620
Classification Level Classification E-value
Superfamily Spectrin repeat 2.55e-18
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 11 Region: 2480-2544
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000924
Family SH3-domain 0.0002
Further Details:      
 
Domain Number 12 Region: 1593-1684
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000462
Family SH3-domain 0.0024
Further Details:      
 
Domain Number 13 Region: 14-168
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.000000000157
Family CRAL/TRIO domain 0.011
Further Details:      
 
Domain Number 14 Region: 625-732
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000948
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 15 Region: 172-288
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000222
Family Spectrin repeat 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005635   Gene: ENSFCAG00000006063   Transcript: ENSFCAT00000006065
Sequence length 3031
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:227530778:227763101:-1 gene:ENSFCAG00000006063 transcript:ENSFCAT00000006065 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGFRKNDEMKAMDVLPILKEKVAYLSGGRDKRGGPILTFPARSNHDRIRQEDLRRLISYL
ACIPSEEVCKRGFTVIVDMRGSKWDSIKPLLKILQESFPCCIHVALIIKPDNFWQKQRTN
FGSSKFEFETNMVSLEGLTKVVDPSQLTPEFDGCLEYNHEEWIEIRVAFEDYISNATHML
SRLEELQDILAKKELPQDLEGARNMIEEHSQLKKKVIKAPIEDLDLEGQKLLQRIQSSDS
FPKKNSGSGNADLQSLLPKVSAMLDRLHSTRQHLHQMWHVRKLKLDQCFQLRLFEQDAEK
MFDWITHNKGLFLNSYTEIGTSHPHAMELQTQHNHFAMNCMNVYVNINRIMSVANRLVES
GHYASQQIKQIANQLEQEWKAFAAALDERSTLLDMSSIFHQKAEKYMSNVDSWCKACGEV
DLPSELHDLEDAIHHHQGVYEHITLAYSEVSQDGKSLLDKLQRPLTPGSSDSLTASANYS
KAVHHVLDVIHEVLHHQRQLENIWQHRKVRLHQRLQLCVFQQDVQQVLDWIENHGEAFLS
KHTGVGKSLHRARALQKRHEDFEEVAQNTYTNADKLLEAAEQLAQTGECDPEEIYQAAHQ
LEDRIQDFVRRVEQRKILLDMSVSFHSHVKELWTWLEELQKELLDDVYAESVEAVQDLIK
RFGQQQQTTLQVTVNVIKEGEDLIQQLRDSAISSNKTPHNSSISHIETVLQQLDEAQAQM
EELFQERKIKLELFLQLRVFERDAIDIISDLESWNDELSQQMNDFDTEDLTIAEQRLQHH
ADKALTMNNLTFDVIHQGQDLLQYVNEVQASGVELLCDRDVDMATRVQDLLEFLHEKQQE
LDVAAEQHRKHLEQCVQLRHLQAEVKQVLGWIRNGESMLNAGLITASSLQEAEQLQREHE
QFQHAIEKTHQSALQVQQKAEAMLQANHYDMDMIRDCAEKVASHWQQLMLKMEDRLKLVN
ASVAFYKTSEQVCSVLESLEQEYKREEDWCGGADKLGPNSETDHVTPMISKHLEQKEAFL
KACTLARRNADVFLKYLHRNSVNMPGMVTHIKAPEQQVKNILNELFQRENRVLHYWTMRK
RRLDQCQQYVVFERSAKQALEWIHDNGEFYLSTHTSTGSSIQHTQELLKEHEEFQITAKQ
TKERVKLLIQLADGFCEKGHAHAAEIKKCVTAVDKRYRDFSLRMEKYRTSLEKALGISSD
SNKSSKSLQLDIIPASVPGSEVKLRDAAHELNEEKRKSARRKEFIMAELIQTEKAYVRDL
RECMDTYLWEMTSGVEEIPAGIVNRELVIFGNMQEIYEFHNNIFLKELEKYEQLPEDVGH
CFVTWADKFQMYVTYCKNKPDSTQLILEHAGSYFDEIQQRHGLANSISSYLIKPVQRITK
YQMMIIKELLTCCEEGKGEIKDGLEVMLSVPKRANDAMHLSMLEGFDENIESQGELILQE
SFQVWDPKTLIRKGRERHLFLFEMSLVFSKEVKDSSGRSKYLYKSKLFTSELGVTEHVEG
DPCKFALWVGRTPASDNKIVLKASSIENKQDWIKHIREVIQERTIHLKGALKEPIHIPKT
APATRQKGRRDGEDLDSQGDGSSQPDTISIASRTSQNTLDSDKLSGGCELTVVIHDFTAC
NSTELTIRRGQTVEVLERPHDKPDWCLVRTTDRSPAAEGLVPCGSLCIAHSRSSMEMEGI
FNHKDSLSVSSNDASPPASVASLQPHMMGAQSSPGPKRPGNTLRKWLTSPVRRLSSGKAD
GHVKKLAHKHKKSREVRKSADAGSQKDSDDSAATPQDETVEERGRNEGLSSGTLSKSSSS
GMQSCGEEEGEEGADAVPLPPPMAIQQHSLLQPDSQDDKASSRLLVRPTSSETPSAAELV
SAIEELVKSKMALEDRPSSLLVDQGDSSSPSFNPSDNSLLSSSSPIDEMEERKSSSLKRR
HYVLQELVETERDYVRDLGCVVEGYMALMKEDGVPDDMKGKDKIVFGNIHQIYDWHRDFF
LGELEKCLEDPEKLGSLFVKHERRLHMYIVYCQNKPKSEHIVSEYIDTFFEDLKQRLGHR
LQLTDLLIKPVQRIMKYQLLLKDFLKYSKKASLDTSELERAVEVMCIVPKRCNDMMNVGE
LGFKGKIVAQGKLLLQDTFLVTDQDSGLLPRCKERRVFLFEQIVIFSEPLDKKKGFSMPG
FLFKNSIKVSCLCLEENVENDPCKFALTSRTGGVVETFTLHSSSPSVRQTWIHEINQILE
NQRNFLNVFLLSTITYAKSYSGGLSTIRNAVGALGMSHLSLSPFVPVRGHGQDRSSFPSL
PSGAKLAKQGVTRGIPELSAASLLSGLKKTFVASGLNSPTGRRPTALPQPHSGPPAPWTW
PSLPPAPATHTGTPPVVESVPVVYNHMDEPRLEGGGYSGPAYPFDCNLCLSPLPHEDIFL
GVLTVSSGSPLFCSIDITNRVSEEPASRPGSFTFPGDSDSLQRQAQRHAAPGKDTDRMST
CSSASEQSVQSTQSNGSESSSSSNISTMLVTHDYTAVKEDEINVYQGEVVQILASNQQNM
FLVFRAATDQCPAAEGWIPGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKD
GKREGKLENGYRKSREGLSNKVSVKLLNPNYIYDVPPEFVIPLSEVTCETGETVVLRCRV
CGRPKASITWKGPEHNTLNNDGHYSISYSDLGEATLKIVGVTTEDDGTYTCIAVNDMGSA
SSSASLRVLGPGSDGIMVTWKDNFDSFYSEVAELGRGRFSVVKKCDQKGTKRAVATKFVN
KKLMKRDQVTHELGILQNLQHPLLVGLLDSFETPTSYILVLEMADQGRLLDCVVRWGNLT
EGKIRAYLGEVLEAVRYLHNCRIAHLDLKPENILVDQSSAKPTIKLADFGDAVQLNTTYY
IHQLLGNPEFAAPEVILGNPISLTSDTWSVGVLTYVLLSGVSPFLDDSVEETCLNICRLD
FSFPEDCFKGVSQKAKEFVCFLLQEDPAKRPSAALALQEQWLQAGHGSGKGAGVLDTSRL
TSFIERRKHQNDVRPIRSVKNFLQSRLLPRV
Download sequence
Identical sequences ENSFCAP00000005635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]