SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000005819 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000005819
Domain Number 1 Region: 340-598
Classification Level Classification E-value
Superfamily Kelch motif 6.02e-40
Family Kelch motif 0.00093
Further Details:      
 
Domain Number 2 Region: 42-166
Classification Level Classification E-value
Superfamily POZ domain 1.49e-32
Family BTB/POZ domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000005819   Gene: ENSFCAG00000006263   Transcript: ENSFCAT00000006265
Sequence length 679
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A1:29019105:29021144:1 gene:ENSFCAG00000006263 transcript:ENSFCAT00000006265 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSREEAPRSRRLASPRGGRRPKRISKPSVSAFFTGPEELKDTAHSAALLAQLKSFYDAR
LLCDVTIEVVTPGSGPGTGRLFSCNRNVLAAACPYFKSMFTGGMYESQQASVTMHDVDAE
SFEVLVDYCYTGRVSLSEANVQRLYAASDMLQLEYVREACASFLARRLDLANCTAILKFA
DAFDHHKLRSQAQSFIAHNFKQLSRMGSVREESLADLSLAQLLAVLRLDSLDIESERTVC
HVAMQWLETAPKERGPNAAEVFKCVRWTHFRDEDQDYLEGLLTKPIVKKYCLDLIEGALQ
MRYGDMLYKSVVPKPESSSSSVVSVAENPPQRLGMCAKEMVIFFGHPRDPFLCYDPYSGD
IYTMPSPLTSLAHTKTITSSAVCVSPDHDIYLAAQPRKDLWVYKPAQNSWQQLADRLLCR
EGMDVAYLNGYIYILGGRDPITGVKLKEVECYSVQRNQWALVAPVPHSFYSFELIVVQNY
LYAVNSKRMLCYDPSHNMWLNCASLKRSDFQEACVFNDEIYCICDIPVMKVYNPARGEWR
RISNIPLDSETHNYQIVNHGQKLLLITSTTPQWKKNRVTVYEYDTREDQWINIGTMLGLL
QFDSGFICLCARVYPSCLEPGQSFITEEDDARSESSTEWDLDGFSELDSESGSSSSFSDD
EVWVQVAPQRNAQDQQGSL
Download sequence
Identical sequences M3W5K6
ENSFCAP00000005819 XP_003980468.1.62641 XP_019302945.1.44245

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]