SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000006571 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000006571
Domain Number 1 Region: 198-336
Classification Level Classification E-value
Superfamily C-type lectin-like 1.4e-33
Family C-type lectin domain 0.00069
Further Details:      
 
Domain Number 2 Region: 339-477
Classification Level Classification E-value
Superfamily C-type lectin-like 4.02e-31
Family C-type lectin domain 0.00081
Further Details:      
 
Domain Number 3 Region: 1094-1213
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-27
Family C-type lectin domain 0.00072
Further Details:      
 
Domain Number 4 Region: 1519-1651
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-27
Family C-type lectin domain 0.00055
Further Details:      
 
Domain Number 5 Region: 1378-1504
Classification Level Classification E-value
Superfamily C-type lectin-like 2.62e-27
Family C-type lectin domain 0.0019
Further Details:      
 
Domain Number 6 Region: 938-1081
Classification Level Classification E-value
Superfamily C-type lectin-like 5.06e-27
Family C-type lectin domain 0.0039
Further Details:      
 
Domain Number 7 Region: 624-781
Classification Level Classification E-value
Superfamily C-type lectin-like 5.83e-26
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 8 Region: 21-143
Classification Level Classification E-value
Superfamily Ricin B-like lectins 7.37e-26
Family Cysteine rich domain 0.0039
Further Details:      
 
Domain Number 9 Region: 1653-1784
Classification Level Classification E-value
Superfamily C-type lectin-like 1.57e-22
Family C-type lectin domain 0.004
Further Details:      
 
Domain Number 10 Region: 1226-1348
Classification Level Classification E-value
Superfamily C-type lectin-like 7.35e-19
Family C-type lectin domain 0.0034
Further Details:      
 
Domain Number 11 Region: 485-614
Classification Level Classification E-value
Superfamily C-type lectin-like 7.7e-19
Family C-type lectin domain 0.0024
Further Details:      
 
Domain Number 12 Region: 142-198
Classification Level Classification E-value
Superfamily Kringle-like 3.71e-16
Family Fibronectin type II module 0.002
Further Details:      
 
Domain Number 13 Region: 787-921
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000138
Family C-type lectin domain 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000006571   Gene: ENSFCAG00000007081   Transcript: ENSFCAT00000007084
Sequence length 1861
Comment pep:known chromosome:Felis_catus_6.2:C1:149423872:149557188:-1 gene:ENSFCAG00000007081 transcript:ENSFCAT00000007084 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLLLLLLRCCGLAEPSGRAGNDPFTVVNENMGKCIKPLNDWIIATDCDGSRDMLWKWVSQ
HRLFHLQSQKCLGLDITKPTDSLRMFSCDSSAMLWWKCEHYSLYGAAQYRLALKNGHAIA
STNSSDVWKKGGTEENLCDQPYHEIYTRDGNSYGRPCEFPFLVNGTWHHECIRDENHGGP
WCATTLNYEYDQKWGICLIPENGCEDNWEKNEQIGSCYQFNTQASLSWKEAYVSCQNQGA
NLLSISDADELTYLKEKEGIPRIFWIGLNQLYSARGWEWSDHKPLNFLNWDPDMPSAPMI
IGGSSCARMDARSGLWQSFSCEVQLPYVCKKPLNNTAELTDVWTYSDTRCDAGWMSNNGF
CYLLVNESDSWDKAHMKCKALSSDLISIHSLADVEVVVTKLHHGDAKEEIWTGLKNENIP
TLFQWSDDTEVTLTYWNKNEPNVPYNKTPNCVSYLGKLGQWRVQSCEEKLKYVCKKKGEQ
MNDTTSDKICPPDEDWKRHGETCYKIYKDEVPFGTKCNLTITSRFEQEYLNDMIKKYTNS
PGKYFWTGLRDTDSHGEYSWTGVGGVKQAVTFSNWNFLEPASPGGCVAMATGKSLGKWEV
KDCRKFRALSICKKISGPIEPEEVAPKPEAPCPEGWHSFPSSISCYKLFHIERIVRKRNW
EEAERFCQALGGHLPSFSHMDEIKEFLHFLMDQFSDQRWLWIGLNKRSPDLQGSWEWSDH
TPVSTIIMENEFQQDYDIRDCAAVKVIHRPGRRSWYFYDDREFIYLRPFACDTKLEWVCQ
IPKGFTPKTPDWYNPERAGIHGPPVVIEGSEYWFVADPHLNYEEAVLYCASNHSSLATLT
SLTGLKAIKNKIANISGDEQKWWVRTGEQPIDRHFLNSRYLWHHFPITFREECLYMSAKT
WFSDLNKPADCSTKLPFICEKYNVSSLEKYSPDSAAKIQCSGDWIAFQNKCFLKIKPKSL
TFSQASDTCHTYGGTLPSVLSQREQDFITSLLPDMEATLWIGLRWTAYERINKWTDNREL
TYSNFHPLLSGWRLKIPTNIFEEESQYHCALMLNLEKSPYTGTWNFTSCSEHHTLSLCQR
YSEIESRQTLQNTSDTIKYLNNLYKIIPKSLTWFDALKECQKDNMHLVSITDPYQQAFLT
VQTVLHNSSLWIGLSSRDDELNYGWSDGKHLQFSRWIENNNQLEDCVILDTDGFWKTSDC
EHQQPGAICYYPGNETEKEIKPVDSVQCPSPVLSTPWIPFQNSCYNFMVGKTKYHAVTPD
EVHSKCQNLNPKSHVLSIRDEKENNFVLEQLLHLNNMALWVTLGITYENNSLLWSDKTML
SYTNWRGGRPDIKNGNFFAGLSTDGFWDIQTFNAIEEIFYYNQNSILACKIEMVDYKEEY
NATLPLFIPYEDGIYNVIQKKVTWYEALNMCSQSGGYLASVHDQNGQLFLEDIVKRDGFP
LWVGLSSHDGSESSFEWSDGSTFDYIPWKDKKSAGNCVVLDPKGIWTHEKCKSVRDGAIC
YKPTKSKEVSSHTYSSRCPAVKGNESQWIQYRDHCYASNQALHSFLEAEQFCSKLDHSAT
IVTIEDEDENKFVSRLMRENNNITMRVWLGLSQHSTDQSWNWLDGSKVTFVKWANKIKSG
DGKCSILLASNETWIKVECSHGYGRVVCKAPLDCPSSTWVQFQDSCYIFLQEAIKVESIE
DVRNQCTDHGADMVSIHNEEENAFILETLKKQWKGPDDILLGMFFDTDDASFKWFDKSNM
TFDKWTDQEDGEDLVDTCAFLHTKTGEWKKGNCEISSVEGTLCKAASKYNKLFSNNHILI
SALVIASTVILTVLGAIVWFLYKRNLDSGFTTVFSTAPQSPYNDDCVLVVAEENEYAVQF
D
Download sequence
Identical sequences ENSFCAP00000006571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]