SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007427 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007427
Domain Number 1 Region: 7-188
Classification Level Classification E-value
Superfamily p53-like transcription factors 2.77e-75
Family Rel/Dorsal transcription factors, DNA-binding domain 0.0000000466
Further Details:      
 
Domain Number 2 Region: 183-306
Classification Level Classification E-value
Superfamily E set domains 2.4e-45
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.00000342
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007427   Gene: ENSFCAG00000008018   Transcript: ENSFCAT00000008020
Sequence length 583
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:81258234:81282491:1 gene:ENSFCAG00000008018 transcript:ENSFCAT00000008020 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KFPGGYNPCIEIIEQPRQRGMRFRYKCEGRSAGSIPGEHSTDNNRTYPSIQIMNYYGKGK
VRITLVTKNDPYKPHPHDLVGKDCRDGYYEAEFGQERRPLFFQNLGIRCVKKKEVKEAII
SRIRAGINPFNVPEQQLLDIEDCDLNVVRLCFQVFLPDEHGNLTTALPPVVSNPIYDNRA
PNTAELRICRVNKNCGSVRGGDEIFLLCDKVQKDDIEVRFVLNDWEAKGIFSQADVHRQV
AIVFKTPPYCRAITEPVTVKMQLRRPSDQEVSESMDFRYLPDEKDTYGNKAKKQKTTLLF
QKLWQDCVNFPERPRPGLGSTGEGRFIKKESNFSHGAVLTDMSRTSGISSQADSYYSSSV
SISSALSHHTSAIPAMVSQPSSWSSGAHPTSRSVNTNPLSSFSTGTLSSNSQGVSPYLEI
PLVSDLNASNACIYNNANDIGRMEASSMSSADLYGISDANMLPNCPVNMNDSMRESDNPR
LVSMNLENPSCNSVLDPRDLRQLHQMSSSSLSAGASSSTTAFVAQSEAFEGSDFNCTDNS
MMNESGPSNGTNPNSHGFVHSQYSGIGTMQSEQLSDSFAFEYF
Download sequence
Identical sequences ENSFCAP00000007427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]