SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007548 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007548
Domain Number 1 Region: 67-184
Classification Level Classification E-value
Superfamily C-type lectin-like 7.52e-28
Family C-type lectin domain 0.00000177
Further Details:      
 
Domain Number 2 Region: 466-532
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000114
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 3 Region: 342-408
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000138
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 225-289
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000167
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 5 Region: 590-655
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000195
Family Complement control module/SCR domain 0.0014
Further Details:      
 
Domain Number 6 Region: 534-606
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000292
Family Complement control module/SCR domain 0.0012
Further Details:      
 
Domain Number 7 Region: 287-353
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000000000000542
Family Complement control module/SCR domain 0.001
Further Details:      
 
Domain Number 8 Region: 722-787
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000000000000181
Family Complement control module/SCR domain 0.002
Further Details:      
 
Domain Number 9 Region: 403-470
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000115
Family Complement control module/SCR domain 0.0017
Further Details:      
 
Domain Number 10 Region: 667-731
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000000334
Family Complement control module/SCR domain 0.0018
Further Details:      
 
Domain Number 11 Region: 187-221
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000147
Family EGF-type module 0.00057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007548   Gene: ENSFCAG00000008148   Transcript: ENSFCAT00000008150
Sequence length 855
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F1:11938691:11970411:-1 gene:ENSFCAG00000008148 transcript:ENSFCAT00000008150 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MITNRDLGGHIDFTWVLKGSFPFLFQASCLKAIWNWRFQTVIFRTAQLLCFSALIFELIE
QKEVAAWTYNYSTKAYSWNYSRMFCQKHYTDLVAIQNKKEIAYLNDVMPYFNSYYWIGIR
RINDKWTWVGTKKVLTKEAENWADNEPNNKKNNQDCVEIYIKSVSAPGKWNDEPCWKKKR
ALCYTASCQDMSCSKQGECIETIGNYTCSCFPGFYGPECEYVQECGEFGLPQHVLMNCSH
PLGNFSFNSECSFHCAEGYELNGPSKLKCLASGMWTNNPPQCIAAQCPPLKTPERGSMTC
LPSPEAPQYQSSCHFACEEGFALVGPEVVQCTASGVWTASPPECEVVRCPLLEAPGKGTM
DCVHPLTAFAYGSSCKFECEPGYQVRGRATLRCIGSGQWTTPLPACEAIACEPLESPVHG
STDCSPLSGPLPYNTSCSFRCADGFRLKGADMAQCTDLGRWTAPAPVCEALQCQDLPAPD
QAQVNCSHPFGAFRYQSTCSFSCDEGLLLVGAGELRCLGTGTWSAPPPQCQAFTCTPLLS
PRNGTMTCVQPLGDSSYKSRCQFTCDEGFSLSGPEILDCAPSGHWTGPPPTCEAIKCPEL
FAPEQGSLACSDTRREFSVGYTCHFSCNKGFELEGSNDVECTASGKWTAPPPTCQGVVSA
PLSEVRCPALTTLEQGTVSCRHGLGTFGPNTTCYFGCHAGFTLTGGRALRCRPSGQWTAG
APTCRAVKCSELHGTEPGTMNCSNPWGNFSYGSTCSFHCPEGQLLNGSARTACQENGQWS
TPMPTCQAGPLTIQEALTYFGGAVASTIGLVTCGTLLALLRKRFRQKDDGESPLNPQSHL
GTYGVFTNAAFDPSP
Download sequence
Identical sequences ENSFCAP00000007548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]