SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000007611 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000007611
Domain Number 1 Region: 169-268
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.07e-33
Family Ras-binding domain, RBD 0.0026
Further Details:      
 
Domain Number 2 Region: 311-425
Classification Level Classification E-value
Superfamily PH domain-like 2.74e-16
Family Pleckstrin-homology domain (PH domain) 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000007611   Gene: ENSFCAG00000008212   Transcript: ENSFCAT00000008214
Sequence length 659
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B4:24221800:24282409:1 gene:ENSFCAG00000008212 transcript:ENSFCAT00000008214 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGESNEDIDQMFSNLLGEMDLLTQSLGVDTLPPPDPKPPRAEFNYSVGFKDLNESLNALE
DQDLDALMADLVADISEAEQRTIQAQKEPSQNQNHPAPLNIPNFSGAAALGYGANVAVTS
VSQYEDDLPPPPADPMLDLPLPPPPPEPLSQEEEAALAKADKIKLALEKLKEAKVKKLVV
KVHMNDNSTKSLMVDERQSARDVLDNLFDKTHCDCSVDWCLYEIYPELQIERIFEDHENV
VEVLSDWTRDTENKVLFLEKEEKYAVFKNPQNFYLDNKGKKEGKETSEKMNAKNKESLLE
ESFCGTSVIVPELEGALYLKEDGKKSWKRRYFLLRASGIYYVPKGKTKTSRDLACFIQFE
NVNIYYGIQCKMKYKAPTDHCFVLKHPQIQKESQYIKYLCCDDARTLNQWVMGIRIAKYG
KTLYDNYQRALERAGLASRTNLSTVGAVPPAPPATGPKAGTSQANGQIPQAAHSVNAVLE
EAQRQAETTKDKKPALGNHDPGTPRAHHLPKSSLPPPPPVRRSSDICSSPATTPRAKGMS
SGFPAPPPDDSLPPPPPPPPLEDDEELPPPPPDFNEGPPDFVPPPPPSFAGDAGLSLPPP
PPPPPALNSPKPPPVASKRPPAPPKRKENPGPPGGVGSGEQDFMSDLMKALQKKRGNMS
Download sequence
Identical sequences M3W961
XP_003988223.1.62641 ENSFCAP00000007611

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]