SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008727 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008727
Domain Number 1 Region: 722-778
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 3.75e-16
Family Complement control module/SCR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 28-69
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000157
Family Somatomedin B domain 0.0037
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000008727
Domain Number - Region: 63-135
Classification Level Classification E-value
Superfamily E set domains 0.000406
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008727   Gene: ENSFCAG00000009411   Transcript: ENSFCAT00000009413
Sequence length 820
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D3:24690760:24697792:-1 gene:ENSFCAG00000009411 transcript:ENSFCAT00000009413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PLPLWALLLLLLATVPGPGPGPAAGAKGTCSHRCGDRDGLCSCHPTCSGLNTCCSDFRDF
CLEISPYSGSMMGGKDFVVQHLNWFNPTDGVICRFKESIQTLGRVDSSGHVHCVSPLLYE
TGRIPFTLSMDNGRSFPRSGTWLAVHPSKVSETEKSQLVNETQWQYYGTADTTGNLTLTW
QASALPTETVTIELWGYEETGKPYSGEWTAKWSYLYPLVTNIPNSGFFTFTPKPAPQKYQ
RWEVGALRIINSKYYAGEKDVHALWSNEHALAWHLGDDFQEDPVAWARSQCLAWEELEDQ
LPNFLEELPDCPCTLAQAQATHGGTHTDYGCDIERGSVCTYHPGAVHCVRSVQASPRYAS
GQQCCYTAAGTQLLTADSTGGSTPDRGHDWGAPPFRTPPRVPGLSHWLYDVISFYHCCLW
APDCSRYMRRRPSSDCRSYRPPRLASAFGDPHFITFDGANFTFNGRGEYVLLEATLTNLR
VQGRAEPGTTPEGTRDRGTGLTAVAVQEGNSDVVEVRLAGGAGVLQVLLNQEVLSFTEQS
WMDLNGMFLSAAAGDSVSIMLSSGAGLEVSVQGPFLSVAVLLPEKFLTHTRGLLGTLNDD
PTDDFTLRNGKVLPLSSSSRELFRFGADWAVENASSLLTYDSWFLVNNFLYQPKHDHTFQ
PLFPEEATPNPSQATEAAELCGDNHFCRFDVMATGSLSVGNATRMAHQWHQHRVQSLKPV
RSCGWLAPPPNGLKEGISYLMGSTVHFHCNSGYSLVGAEASTCQADGTWSRPTPVCQPGR
SYAVLLSIIFGGLAVVALVALVYVLLRRRKSNMASWGSQP
Download sequence
Identical sequences ENSFCAP00000008727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]