SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000008810 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000008810
Domain Number 1 Region: 256-511
Classification Level Classification E-value
Superfamily Kelch motif 1.2e-32
Family Kelch motif 0.0048
Further Details:      
 
Domain Number 2 Region: 48-155
Classification Level Classification E-value
Superfamily POZ domain 1.08e-31
Family BTB/POZ domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000008810   Gene: ENSFCAG00000009499   Transcript: ENSFCAT00000009501
Sequence length 534
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:101446439:101451100:-1 gene:ENSFCAG00000009499 transcript:ENSFCAT00000009501 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKGGKTDSWQREKLAAMESPEEPGASMDENYFVNYTFKDRSHSGRVAQGIMKLCLEEELF
ADVTISVEGREFQLHRLVLSAQSCFFRSMFTSNLKEAHNRVIVLQDVSESVFQLLVDYIY
HGTVKLRAEELQEIYEVSDMYQLTSLFEECSRFLARTVQVGNCLQVMWLADRHSDPELYT
AAKHCAKAHLAQLQSTEEFLHLPHHLLTDIISDGVPCSQNPTEAIEAWINFNKEEREAFA
ESLRTSLKEIGENVHIYLIGKESSRTHSLAVSLHCAEDDSISVSGQNSLCHQITAACKHG
GDLYVVGGSIPRRMWKCNNATVDWEWCAPLPRDRLQHTLVSVPGKDAIYSLGGKTLQDTL
SNAVIYYRVGDNVWTETTQLEVAVSGAAGANLNGIIYLLGGEENDLDFFTKPSRLIQCFD
TETDKCHVKPYVLPFAGRMHAAVHKDLVFIVAEGDSLVCYNPLLDSFTRLCLPEAWSSAP
SLWKIASCNGSIYVFRDRYKKGDANTYKLDPATSAITVTRGIKVLLTNLQFVLA
Download sequence
Identical sequences M3WBK0
XP_003993297.1.62641 XP_007082226.1.5354 XP_019267989.1.44245 XP_019267990.1.44245 ENSFCAP00000008810

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]