SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009111 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009111
Domain Number 1 Region: 83-146
Classification Level Classification E-value
Superfamily BPTI-like 7.09e-19
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0031
Further Details:      
 
Domain Number 2 Region: 42-90
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000000536
Family Elafin-like 0.0021
Further Details:      
 
Domain Number 3 Region: 149-193
Classification Level Classification E-value
Superfamily Elafin-like 0.00000000589
Family Elafin-like 0.0018
Further Details:      
 
Domain Number 4 Region: 196-240
Classification Level Classification E-value
Superfamily Elafin-like 0.00000157
Family Elafin-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009111   Gene: ENSFCAG00000009822   Transcript: ENSFCAT00000009824
Sequence length 241
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A3:15220777:15228555:1 gene:ENSFCAG00000009822 transcript:ENSFCAT00000009824 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PTPLVTPHRHLPVHSSVFSPRNVVFLLLLSLSLEETSSSPMKRVKEKPGVCPHERITCET
KVPDWCRTDGHCVEQMKCCSFACGKKCMDPLQEPCMLPSDQGNCNSNIMHWYFDNKHHLC
KPFTYGGCYGNANNFISKEHCIMACTLIVKKGHCPLFPFKNRMECSSLCTSDIDCPQSDK
CCESMCGFVCAMAWTAKSGFCPHKPVVCSTFDRPKCLQDNDCPVSQKCCSHCGLKCLEPQ
K
Download sequence
Identical sequences ENSFCAP00000009111

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]