SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000009553 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000009553
Domain Number 1 Region: 386-436
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000266
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 2 Region: 423-470
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000886
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 3 Region: 90-120
Classification Level Classification E-value
Superfamily SET domain 0.00000563
Family Histone lysine methyltransferases 0.057
Further Details:      
 
Domain Number 4 Region: 132-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000052
Family C2HC finger 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000009553   Gene: ENSFCAG00000010288   Transcript: ENSFCAT00000010294
Sequence length 521
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:92006562:92013871:1 gene:ENSFCAG00000010288 transcript:ENSFCAT00000010294 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MHGTARAPATSVSADCCIPAGLRLGPVPGTFKLGKYLSDRREPGPKKKVRMVRGELVDES
GGSPLEWIGLIRAARNPQEQTLEAIADLPGGQIFYRALRDVQPGEELTVWYSNSLAQWFD
IPTIATPTHDEKGEERYICWYCWRTFRYPNSLKAHLRFHCVLSSGGGRTYLHHEHAARQG
AAPAADGLPFSRKPPAPDFAAPEEASAFKHVERAQPAAPALPGARFAQLPSATGLPVERC
ALPALDAGGLKAYPGGECSHLPAVMPAFTVYNGELLYGSPAAAAYYPLKLHFGGLLKYPE
SISYFSGPAAAAAAAAAAALSPAELGSLASIDREIAMHTQQLSEMAAGKSRGRLDAGTLP
PAVVAAGGAGGGGSVGGGAGKSKTGHLCLYCGKLYSRKYGLKIHMRTHTGYKPLKCKVCL
RPFGDPSNLNKHIRLHAEGNTPYRCEFCGKVLVRRRDLERHVKSRHPGQNLLAKAGDGPG
AEPDYPPEPGEPKSDNDSDVDVCFTDDQSDPEAGGGGERDS
Download sequence
Identical sequences ENSFCAP00000009553

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]