SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010161 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010161
Domain Number 1 Region: 342-471
Classification Level Classification E-value
Superfamily C-type lectin-like 1.56e-41
Family C-type lectin domain 0.0000877
Further Details:      
 
Domain Number 2 Region: 199-331
Classification Level Classification E-value
Superfamily C-type lectin-like 5.06e-37
Family C-type lectin domain 0.00042
Further Details:      
 
Domain Number 3 Region: 791-917
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-34
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 4 Region: 930-1081
Classification Level Classification E-value
Superfamily C-type lectin-like 6.24e-34
Family C-type lectin domain 0.00039
Further Details:      
 
Domain Number 5 Region: 482-617
Classification Level Classification E-value
Superfamily C-type lectin-like 3.61e-33
Family C-type lectin domain 0.001
Further Details:      
 
Domain Number 6 Region: 625-775
Classification Level Classification E-value
Superfamily C-type lectin-like 2.02e-29
Family C-type lectin domain 0.00046
Further Details:      
 
Domain Number 7 Region: 1220-1360
Classification Level Classification E-value
Superfamily C-type lectin-like 5.25e-27
Family C-type lectin domain 0.0018
Further Details:      
 
Domain Number 8 Region: 1087-1215
Classification Level Classification E-value
Superfamily C-type lectin-like 8.94e-25
Family C-type lectin domain 0.0015
Further Details:      
 
Domain Number 9 Region: 5-136
Classification Level Classification E-value
Superfamily Ricin B-like lectins 6.34e-24
Family Cysteine rich domain 0.0035
Further Details:      
 
Domain Number 10 Region: 136-194
Classification Level Classification E-value
Superfamily Kringle-like 1.54e-20
Family Fibronectin type II module 0.00079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010161   Gene: ENSFCAG00000010936   Transcript: ENSFCAT00000010941
Sequence length 1444
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E1:46936463:46958735:1 gene:ENSFCAG00000010936 transcript:ENSFCAT00000010941 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLPEPNVFLIFSHGLQGCLEAQGGQVRVSPACNASLPAQRWKWVSRNRLFNLGAMQCLGT
GWPGTNTTASLGMYECDREALNLRWHCRTLGDQLSLLLGGRTGNTSKAGSPERGDQTRGG
QWRIYGSDEDLCARPYYEVYTIQGNSHGKPCTIPFKYDNQWFHSCTSTGREDGHLWCATT
QDYGKDERWGFCPIKSNDCETFWDKDQLTDSCYQFNFQSTLSWREAWASCEQQGADLLSI
TEIHEQTYINGLLTGYSSTLWIGLNDLDTSGGWQWSDNSPLKYLNWESDQPDNPSEENCG
VIRTESSGGWQNRDCSIALPYVCKKKPNATAERPSPDVWANVKVECEPSWQPFQGHCYRL
QAEKRSWQESKKACLRGGGDLLSIHSMAELEFITKQIKQEVEELWIGLNDLKLQMNFEWS
DGSLVSFTHWHPFEPNNFRDSLEDCVTIWGPEGRWNDSPCNQSLPSICKKAGQLSQGAAE
EDHGCRKGWTWHSPSCYWLGEDQVSYGEARRLCTHHGSQLVTITNRFEQAFVSSLIYNWD
GEYFWTALQDLNSTGSFRWLSGDEVMYTHWNRDQPGYSRGGCVALATGSAMGLWEVKNCT
AFRARYICRQSLGTPVTPELPGPDPTPSLTGSCPQGWGSDPKLRHCYKVFSSERLQDKKN
WVQAQRACQDLGAQLLSLASYEEEHFVANMLNKIFGESEPEIHEQNWFWIGLNRRDPGAG
QSWRWSDGLGFSYHNFDRSRHDDDDIRGCAVLDLASLQWVAMQCETQLDWICKIPRGTDV
REPDVSPQGRREWLRFQEAEYKFFEHHSTWAQAQRICTWFQAELASVHSQAELDFLGHNL
QKFSRGQEQHWWIGLHTAESDGRFRWTDGSIINFISWAPGKPRPIGKDKKCVYMTASRED
WGDQRCLTALPYICKRSNGTGEPQPPDLPPTALGGCPSGWKQFLNKCFRIQGQDPQDRVK
WSEAQFSCEQQEAQLVTIANPLEQAFITASLPNVTFDLWIGLHASQRDFQWVEQEPLLYT
NWAPGEPSGPSPAPSGNIPTSCAVVLHSPSAHFTGRWDDRSCTEETHGFICQKSTDPSLS
PSPAASPPAPGTVLSYLNGTFRLLQKPLRWHDALLLCESRNASLARVPDPYTQAFLTQAS
RGLRTPLWIGLASEEGSRRYSWVSEEPLSYVSWQDGEPQQPGGCAYVDVDGAWRTTSCDT
KLQGAVCGGNSGPPPPRRISYHGSCPQGLADSAWIPFREHCYSFHMELLLGHKEALQRCQ
RAGGAVLSILDEMENVFVWEHLQSSEGQSRGAWLGMNFNPKGGTLVWHDNTAVNYSNWGP
PGLGPSMLSHNSCYWIQSSSGLWRPGACTNITMGVVCKLPRAEESSFSPSAALPENPAAL
VVVLMAVLLLLALLTAALILYRRRQSAERGTFEGARYSRSASGPGEATEKNILVSDMEMN
EQQE
Download sequence
Identical sequences ENSFCAP00000010161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]