SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010435 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010435
Domain Number 1 Region: 36-313
Classification Level Classification E-value
Superfamily L domain-like 6.12e-53
Family Ngr ectodomain-like 0.0065
Further Details:      
 
Domain Number 2 Region: 411-449
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000107
Family EGF-type module 0.021
Further Details:      
 
Domain Number 3 Region: 463-542
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000306
Family Fibronectin type III 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010435   Gene: ENSFCAG00000011235   Transcript: ENSFCAT00000011237
Sequence length 677
Comment pep:known_by_projection chromosome:Felis_catus_6.2:E3:39413773:39415806:-1 gene:ENSFCAG00000011235 transcript:ENSFCAT00000011237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYPRIPLPPMLPPLLLLLLAPVPRVQCCPTGCQCNQPQTVFCAARQGTTVPRNVPPDTAS
LYVFENGITTLDAGSFASLPGLQLLDLSQNQLASLPGGVFQPLANLSNLDLTANRLREIT
NETFRGLRRLERLYLGKNRIRHIQPGAFDTLDSLLELKLQDNELRALPPLHLPRLLLLDL
SHNSLPALEPGTLDTVNVEALRLAGLGLRRLDEGLLGRLRNLHDLDVSDNQLERVPPAIR
GLRGLTRLRLAGNTRIAQLRPESLAGLVALQELDLSNLSLQALPHELSTLFPRLRLLAAA
RNPFNCVCPLSWFGPWVRESRVALASPEETRCHFPPKNAGRLLLDLEYADFGCPATTTTA
TAPTTKPMAWGPTLSPSSPAPTWLSPTQPATEAPSLPPAAPPTLGAPPRPQDCPASICLN
GGTCHLGVHGHLECLCPELFTGLYCESRVRQGPQPSPAPATPEPPQPLPLGIEPASPTSL
RVGLQRYLQGSTAQLRSLRLTYRNLSGPDKRPVTLRLPASLAEYTVTQLRPNATYSICVR
LLGAGRVPEGEEACGEARTPPAVRSNHAPVTQAREGNLPLLIAPALAAVLLAALAAVGAA
YCVRRGRTAAAATHGKGQVGPGTGPLELEGVKAPLEPGPKATEGGGEAPPSGPECEVPLM
GYPGASPQGPLPTKPYI
Download sequence
Identical sequences M3WEQ2
ENSFCAP00000010435 9685.ENSFCAP00000010435 XP_003998956.1.62641 ENSFCAP00000010435

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]