SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000010755 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000010755
Domain Number 1 Region: 611-715
Classification Level Classification E-value
Superfamily PH domain-like 2.02e-19
Family Pleckstrin-homology domain (PH domain) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000010755   Gene: ENSFCAG00000011586   Transcript: ENSFCAT00000011589
Sequence length 861
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:10603510:10616306:1 gene:ENSFCAG00000011586 transcript:ENSFCAT00000011589 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPDYYKPQYLLDFEDRLPSSVQGSDSLSLNSFNSVTSTNLEWDDSAIAPSSEDYDFGDVF
PAVPSVPSTDWEDGDLTDTVSGPRSTASDPTSSKASTKSPTQRHNPFSEDQAETVSSSDT
TPVHTTSQEKGESHTLDLPDACTELEVIRVTKKKKTGKKKKTRSDEEASPLHPSSSQDSC
ARRGDGGSLVSSPGLGRASPDATFTSPQEEGEGPSGTAEGSELPEPGQMGLLIPEMKDTS
MERLGQPLSKVIDQLNGQLDPSAWRSHVRSPDQSFRTGSPGDAPEKPPFCDFSEGLPAPM
DFYRFTVESPSALTSSGSNHDPAGPGQPLHVPGGPATAGQEEGGGRREGQAPGPLEDTPG
EAREPETRALETQLPPAGDGPVPEAEPGTHEALCQLKRDQPSPCLSSAEDSGVDEGQGSP
SEMTHSAEFRVDNNHLLLLMIHVFRENEEQLFKMIRMSTGHMEGTLQLLYVLLTDCYVYL
LRKGAAEKPYLVEEAVSYNELDYVSVGLDQQTVKLVCTNRRKQFLLDTADVALAEFFLAS
LKSAMIKGCREPPYPSILTDATMEKLALAKFVAQESKCEATAVTVRFYGLVHWEDPLDES
LGPVPCHCSPPEGAITKEGMLHYKAGTSYLGKEHWKTCFVVLSNGILYQYPDRTDVTPLL
SVNMGGEQCGGCRRANTTDRPHAFQVILADRPCLELSADSEAEMAGWMQQLCQAVSKGVI
PQGVAPSPCIPCCLVITDDRLFTCHEDCQTSFFRSLGTARLADISAVSTEPGKEYCVLEF
SQDGQQALPPWVIYLSCTSELDRFLSALSSGWKTIYQVDLPHKATQEASSKKFEDALSLI
HSAWQRSDSLCRGRASRDPWC
Download sequence
Identical sequences ENSFCAP00000010755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]