SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011383 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011383
Domain Number 1 Region: 608-789
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.78e-65
Family SPRY domain 0.0000034
Further Details:      
 
Domain Number 2 Region: 5-89
Classification Level Classification E-value
Superfamily DEATH domain 1.77e-23
Family Pyrin domain, PYD 0.0054
Further Details:      
 
Domain Number 3 Region: 379-445
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 6.56e-16
Family B-box zinc-binding domain 0.0016
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000011383
Domain Number - Region: 431-519
Classification Level Classification E-value
Superfamily Apolipoprotein A-I 0.00418
Family Apolipoprotein A-I 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011383   Gene: ENSFCAG00000012268   Transcript: ENSFCAT00000012271
Sequence length 795
Comment pep:known chromosome:Felis_catus_6.2:E3:40356390:40369541:1 gene:ENSFCAG00000012268 transcript:ENSFCAT00000012271 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIKTPSDHLLHSLEGLVPNDFERFKFKLQNTSLEKDQSRIPRGQLQKARPVKLATLLITH
YGEECAVRLTLQVLRAINQNFLAEELHKATDPESLIQESGADGSAVSCSSGENKPKGLRI
PDVLEGDRQRQSGDGAPSLPSSQPEAGRGTQKKPQGKRRDQKTSEGLDMLGKPGARNATL
SSRKCPFPGKLQGERGIDPSVRLRRNASSLGRLQGLNCGSLTGSLGRTKSKINEAHLPSV
QKRPRSLEITIFSGEREVPNPETPLSQEKMRSDNPDSAAILSEVATLNVGATVTPEKGFR
NPEHSMSRKPRDEAVYVLGHAQEGDPVGGTHVRDSCRRSMASRDPKTSDSCSTSWLQSQA
PLLVKNSGDCKQQEGLHMTSLSPKALPQCERHMRQAQLLFCEDHREPICLICRLSQEHRG
HRVRPIEEAALEYKEQIQKQLEYLKDLRKSGEEQRSQGDKKTADFLKQIETRKQRIRHQL
KQLYHFLEEQEKFFMASLEELGQTIGHVRESYSTRASRDIALLNELIGEMEVKQSQPEWE
LMQDIGVTLHRAKMVTVPKPWATPPEVEKKMHLFYQKSEFVEKSMKYFSEILHSEMDTIN
VPELICAQTHAVNVILDTETAHPNLIFSNDLKSVRLGNKWDRLPDSPERFDSCIIALGLP
SFLSGRHYWEVEVGNKTGWILGICKASMSRKGNMTLSPDNGYWVVMMTKRSEFQVSTIPP
TRLQMTEPPRRVGIFLDYTTGDISFYNVTNKSVIYTFTSFSCSGPLQPIFSPGTHDGGKN
TDPLIICPVGGQGPP
Download sequence
Identical sequences ENSFCAP00000011383

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]