SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011613 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011613
Domain Number 1 Region: 327-608
Classification Level Classification E-value
Superfamily Kelch motif 1.44e-86
Family Kelch motif 0.0000000000275
Further Details:      
 
Domain Number 2 Region: 53-177
Classification Level Classification E-value
Superfamily POZ domain 6.8e-30
Family BTB/POZ domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011613   Gene: ENSFCAG00000012518   Transcript: ENSFCAT00000012520
Sequence length 624
Comment pep:known_by_projection chromosome:Felis_catus_6.2:A2:7737152:7743340:-1 gene:ENSFCAG00000012518 transcript:ENSFCAT00000012520 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQPEPRPSGAGARTRFLPLRSQRPEGAGDAVMYASTECKAEVTPSQHGNRTFSYTLEDHT
KQAFGIMNELRLSQQLCDVTLQVKYEDAPAAQFMAHKVVLASSSPVFKAMFTNGLREQGM
EVVSIEGIHPKVMERLIEFAYTASISMGEKCVLHVMNGAVMYQIDSVVRACSDFLVQQLD
PSNAIGIANFAEQIGCAELHQRAREYIYMHFGEVAKQEEFFNLSHCQLVTLISRDDLNVR
CESEVFHACIDWVKYDCEQRRFYVQALLRAVRCHSLTPRFLQMQLQKCEILQADSRCKDY
LVKIFQELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQV
PRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMTNQWSPCAPMSVPRNRIGVGV
IDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG
TNRLNSAECYYPERNEWRMIAPMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVE
TETWTFVAPMKHRRSALGITVHQGRIYVLGGYDGHTFLDSVECYDPDTDTWSEVTHMTSG
RSGVGVAVTMEPCRKQIDQQNCTC
Download sequence
Identical sequences M3WH36
ENSFCAP00000011613 XP_003981907.1.62641 ENSFCAP00000011613 9685.ENSFCAP00000011613

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]