SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011623 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011623
Domain Number 1 Region: 74-121
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000759
Family TSP-1 type 1 repeat 0.0042
Further Details:      
 
Domain Number 2 Region: 35-76
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000353
Family Somatomedin B domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011623   Gene: ENSFCAG00000012527   Transcript: ENSFCAT00000012530
Sequence length 264
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F2:22412798:22438331:-1 gene:ENSFCAG00000012527 transcript:ENSFCAT00000012530 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTLWMALCALARLWPGTLAGCAEAGRCCPGRDAACFVRGWRLDRVYGTCFCDQACRLTG
DCCFDYARACPARPCIVGEWSPWSRCGDQCKPAARVRRRPVRQEPRNGGAPCPPLEERAG
CLDYSTPRGQDCGHSFVPAFITTSAFNKERTRQSTSPQWSTDTEDSGYCMEFKTESLTHH
CALENRPLTRWMQYLREGYTVCVDCQPPAMNSVSLRCSGDGLDSDGNQTLHWQAIGNPRC
QGTWKKVRRVDQCSCPAVHSFIFI
Download sequence
Identical sequences A0A2I2V191
ENSFCAP00000011623 XP_003999940.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]