SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011709 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011709
Domain Number 1 Region: 314-582
Classification Level Classification E-value
Superfamily Kelch motif 8.89e-68
Family Kelch motif 0.0000298
Further Details:      
 
Domain Number 2 Region: 42-162
Classification Level Classification E-value
Superfamily POZ domain 1.19e-32
Family BTB/POZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011709   Gene: ENSFCAG00000012623   Transcript: ENSFCAT00000012626
Sequence length 604
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:48104483:48106366:1 gene:ENSFCAG00000012623 transcript:ENSFCAT00000012626 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLSPAQICAKGRLSHMKVSLGNGEMGVSAHLQPCKAGTTRFFTSNTHSSVVLQGFDQLRI
EGLLCDVTLVPGDGDEIFPVHRAMMASASDYFKAMFTGGMKEQDLMCIKLHGVNKVGLKK
IIDFIYTAKLSLNMDNLQDTLEAASFLQILPVLDFCKVFLISGVSLDNCVEVGRIANTYN
LIEVDKYVNNFILKNFPALLSTGEFLKLPFERLAFVLSSNSLKHCTELELFKAACRWLRL
EDPRMDYAAKLMKNIRFPLMTPQDLINYVQTVDFMRTDNTCVNLLLEASNYQMMPYMQPV
MQSDRTAIRSDSTHLVTLGGVLRQQLVVSKELRMYDERAQEWRSLAPMDAPRYQHGIAVI
GNFLYVVGGQSNYDTKGKTAVDTVFRFDPRYNKWMQVASLNEKRTFFHLSALKGHLYAVG
GRSAAGELATVECYNPRMNEWSYVAKMSEPHYGHAGTVYGGLMYISGGITHDTFQNELMC
FDPDTDKWAQKAPMTTVRGLHCMCTVGDKLYVIGGNHFRGTSDYDDVLSCEYYSENKIYV
VGGYSWNNRCMVEIVQKYDPEKDEWHKVFDLPESLGGIRACTLTVFPPEENPGSPSRESP
LSAP
Download sequence
Identical sequences ENSFCAP00000011709

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]