SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011733 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011733
Domain Number 1 Region: 907-1198
Classification Level Classification E-value
Superfamily Terpenoid cyclases/Protein prenyltransferases 8.9e-87
Family Complement components 0.0000226
Further Details:      
 
Domain Number 2 Region: 1279-1407
Classification Level Classification E-value
Superfamily Alpha-macroglobulin receptor domain 3.53e-31
Family Alpha-macroglobulin receptor domain 0.0015
Further Details:      
 
Domain Number 3 Region: 742-794
Classification Level Classification E-value
Superfamily E set domains 0.00000000378
Family SVA-like 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011733   Gene: ENSFCAG00000012653   Transcript: ENSFCAT00000012657
Sequence length 1443
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:69061749:69189680:1 gene:ENSFCAG00000012653 transcript:ENSFCAT00000012657 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LITLPLTSACHSVCHPVLFVAYKMPRFLVTAPGVIRPGGNVTVGVELLEHSPSQVTVKAE
VIKMAANLTVSVLEAEGVFEKGSFKTLTLPSLPLNSADGIYELRVTGRAQDEILFSNSTR
LSFETKRMTVFIQTDKSLYKPKQEVKFRVVTLFSDFKPYKTSLNILIKENTRHLIITWLS
EQSDLGIVSKTFQLSSHPILGDWSIQVQVNDQTYYQSFQVSEYVLPKFEVTLQTPLYCSL
NSKSLNGTVTAKYTYGKPVKGDVTLTFLPLSFWGRKKNITKNFKINGSANFSFNDEEMKK
VMDFSEGFSEYMYLSSPGPVEILATVTESLTGISRNASSNVFFKQHDYIIEFFDYATVLK
PSLNFTATVKVTRADGNRLTFEERRNNVVITVTQKNSSEYWSRWGSRNQELEAVQIINYT
VPQNGIFKIEFPILDDSNELQLEASFLNSVSSMAVHGMFKSPSKAYIQLKTRDENIKVGS
PFELVVSGNKPLRKELSYMVISRGQLVAVGKQNSTAFSLTPENSWAPKACIIVYYIEDDG
EIINDVLKIPVQLVFKNKIKLFWSKTHAAPSEKVSLRISVTQPDSIVGVVAVDKSVNLMN
ASNDITMENVVHELELYNTGYYLGMFMNSFAVFQECGLWVLTDANLMKDYIDGVYDSVEL
AERFVEENEGYLVDFHDFSSVSDPRVRKHFPETWIWLDTNMGSKIYQDFEVTVPDSITSW
VATAFVISEDLGLGLTRTPVELQAFQPFFIFLNLPYSVIRGEEFALEVTIFNYLKDATEV
QVIIEKSDKFDILMALNEINATGHQQTILVPSEDGATVVFPVKPTHLGEIPITVTAISPA
ASDAVTQRILVKAEGIEKLYSQSILLDLAVHKLQTPLKTLSFSFPPNTVSGSERVQITAI
GDILGSSINGLASLIRMPYGCGEQNMINFAPNIYVLDYLTKKKQLTENLKEKALSFMRQG
YQRELLYQREDGSFSAFGNDDPSGSTWLSAFVLRCFLEADPYIDIDENVLHRTYTWLKGR
QKSNGEFWEPGRVIHSELQGGNKSPVTLTAYIVTSLLGYKKYQPNIDVQESINFLESEFN
RGISDNYTLALITYALSSVGSPKAKEALNMLTWRAEQEEGMQFWVSSESKLSESWQPRSL
DIEIAAYALLSHFLQYQVSEGIPIMRWLSRQRNSLGGFLSSMDTIVALKALSEFAALMNT
ESTNVQVTVMGPSSPSPIKFQIDRHNRFLLQMAELSVVQPTAVNISASGFGFAICQLNVI
YNVKDSGSSRRRRSVQDQEAFDLDVAVKDNKDDINHLNLNVCTRFLGPARSGMALMEVNL
LSGFTVPSDAIPLSETVKKVEHDHGKLNLYLDSVNETQFCVDIPAVRNFKVSNTQDALVS
IVDYYEPRRRAVRSYNSEAKLSSCDLCGDIRGCGPCESGAAASLCRPSEIFVLCLTLLFS
LHQ
Download sequence
Identical sequences ENSFCAP00000011733

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]