SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000011774 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000011774
Domain Number 1 Region: 706-780
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000144
Family Fibronectin type III 0.0039
Further Details:      
 
Domain Number 2 Region: 114-157
Classification Level Classification E-value
Superfamily Elafin-like 0.0000000562
Family Elafin-like 0.0015
Further Details:      
 
Domain Number 3 Region: 518-563,900-933
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000188
Family Growth factor receptor domain 0.013
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000011774
Domain Number - Region: 313-377
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000453
Family Fibronectin type III 0.0074
Further Details:      
 
Domain Number - Region: 389-469
Classification Level Classification E-value
Superfamily SEA domain 0.00124
Family SEA domain 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000011774   Gene: ENSFCAG00000012699   Transcript: ENSFCAT00000012702
Sequence length 1328
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C2:3868165:3928523:-1 gene:ENSFCAG00000012699 transcript:ENSFCAT00000012702 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGTLGLALLALVGTVGPSQASGFTENGLSLLSFQLCNYSVTRNVQKVEAVHTSHVTYAP
CGGWIPWRRCPKTVYRTRYLAVDVPQPRNVTDCCRGYEQLGLYCVPPLNRSREFASRPGV
CPAVGPEAPASPCTLDTDCPGLQKCCVSPRGHHCVAPAPRAPERDPVTFWYDVTVLVKMA
FKELEEVDPRLLNHMRLLYSMVTSALQPLPSVHHLQSASGDPSTTVSQLLLGLPWPVPVA
NVSATLHSIVQRVYEVIDIRVQGLNDNLFEVLSGVSPPPLWGPPLWSLCPAEFPPGGIDS
KRTLWFQWRGDCPPIRDYITVNVTSSSFRVSWRLHSPWPRTFHVQVYKGEELLRSARTAE
RSLEVAGLEAGELYGVRTGYQGCGANVTATLAVRTDARVFQVTVRVLNRNVTGALLNRSS
TEFRDFSRQLLHEVENSFPPAVSDLHRRGKLRTQMVSLQAGSVVATLRLTVQDPEFPVGV
STLAPMLPPLLASTVFQIDPRGTLVQDWDECADSRGHDCSPAAQCINVEGSYTCRCRTAR
DANPSRAGRACEAGDVVSPTGGVLAPATGVTAPALSTETAALGPETSTLWPSPGHPGGTP
AANQAQTPGPPPRRGGSGPVGKDKNSTRQGLEEGAPRDSSTERPLWPSPTEGPTDHIVWH
ASLPTGDTAPAALDPTRPQNSVPGPSGSPDLLSAPTPESLKLPACVPVPIERVTVSNVTS
TSFHVAWAAGLTPHPTFQLTLTSPRSPAVHLETRDASLTLSGLEPGVLYLVEIAAKACGN
GSARARLKVRTAAQKLRGKVRIANVRYVEPFRNASSREYQDFLELFFRVVRDSLPAAMLR
HVDAGGVQMEVTRVANGSVVVEFNLLIIADVDVREVSAAFLVALRNASLLEVVGEDTFIQ
DYDECDSQEHDCEPGASCHNTLGSYTCSCPGGAPRFPVEFSGRSCDGDSPGNTTQAPGPP
LATGPEQAPTPTGTTAAMAPGASPGPRGLPPRLNLTEAVRVLCDIEKVAIAVQRRFLQQE
SIPESSLYLGHPSCNVSDHNSTHVLLVAGWSECGTVVQSNVTNTVVRTTLRNDLSPEGII
HHLKILSPIHCAFQNDLLTSSGYTPEWGVYTIIEDLHGAGSFVTEMRLFIGDSPIPRNYS
VSASDDVKIEVGLYKQKSNLKVVLTECWATPSSNARDPVMFGFINNSCPIPNTHTNVIKN
GDSSKAQFKLKIFSFINNSIVYLHCRLRICMDSPGSTCKINCNDVKSPRSSEASTIHQTS
WGPLVRSEGERPGAEPGLGAGYLVLIVVAVFAVVAGAAALVLVHYQRMSRKYSFRAGPDD
FGYQVFSG
Download sequence
Identical sequences ENSFCAP00000011774

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]