SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000012223 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000012223
Domain Number 1 Region: 313-545
Classification Level Classification E-value
Superfamily Kelch motif 2.62e-72
Family Kelch motif 0.00000248
Further Details:      
 
Domain Number 2 Region: 41-158
Classification Level Classification E-value
Superfamily POZ domain 2.94e-36
Family BTB/POZ domain 0.00056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000012223   Gene: ENSFCAG00000013180   Transcript: ENSFCAT00000013184
Sequence length 570
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F1:15542604:15597419:1 gene:ENSFCAG00000013180 transcript:ENSFCAT00000013184 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRRCTNIRPGETGMDVTSRCTLGDPNKLPEGVPQPARMPYISDKHPRQTLEVINLLRKHR
ELCDVVLVVGAKKIYAHRVILSACSPYFRAMFTGELAESRQTEVVIRDIDERAMELLIDF
AYTSQITVEEGNVQTLLPAACLLQLAEIQEACCEFLKRQLDPSNCLGIRAFADTHSCREL
LRIADKFTQHNFQEVMESEEFMLLPANQLIDIISSDELNVRSEEQVFNAVMAWVKYSIQE
RRPQLPQVLQHVRLPLLSPKFLVGTVGSDPLIKSDEECRDLVDEAKNYLLLPQERPLMQG
PRTRPRKPIRCGEVLFAVGGWCSGDAISSVERYDPQTNEWRMVASMSKRRCGVGVSVLDD
LLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTCRTSVGVAVLGGFLYAVGGQDGVS
CLNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVERYNPQEN
RWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVVAMTSRRS
GVSASLLKTWGKSTKRRLCGRALICKIPGQ
Download sequence
Identical sequences ENSFCAP00000012223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]