SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013315 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013315
Domain Number 1 Region: 318-611
Classification Level Classification E-value
Superfamily Kelch motif 4.58e-70
Family Kelch motif 0.0000716
Further Details:      
 
Domain Number 2 Region: 51-165
Classification Level Classification E-value
Superfamily POZ domain 1.1e-25
Family BTB/POZ domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013315   Gene: ENSFCAG00000014353   Transcript: ENSFCAT00000014357
Sequence length 634
Comment pep:known_by_projection chromosome:Felis_catus_6.2:B2:53805108:53808697:-1 gene:ENSFCAG00000014353 transcript:ENSFCAT00000014357 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPKKKTVKKNKGDINEMTIIVEDSPLNKLNALNGLLEGGNGLNCISSELTDASYGPNLL
EGLSRMRQENFLCDLVIGTKTKSFDVHKSVMASCSEYFYNILKKDPSTQRVDLNDISPLG
LATVIAYAYTGKLTLSLYTIGSIISAAVYLQIHTLVKMCSDFLIREMSVENCMYIANIAE
TYSLKNAKAATQKFIRDNFLEFAESDQFLKLTFEQINELLIDDDLQLPSEIVAFQIAMKW
LEFDQKRVRYAADLLSNIRFGTISAQDLVNYVQSVPRMMQDADCHKLLVDAMNYHLLPYH
QNTLQSRRTRIRGGCRVLVTVGGRPGLTEKSLSRDILYRDPENGWSKLTEMPAKSFNQCV
AVMDGFLYVAGGEDQNDARNQAKHAVSNFCRYDPRFNTWIHLASMNQKRTHFSLSVFNGL
LYAVGGRNTEGSLASLECYVPSTNQWQPKTPLEVARCCHASAVTDGRVLVTGGYIGNAYS
RSVCAYDPAGDSWQELPGLSTPRGWHCAVTLGDRVYVMGGSQLGARGERVDVLTVECFSP
ATGQWSYAAPLLVGVSTAGASALHGRAYLVGGWNEGEKKYKKCIQCFSPELNEWMEDDEL
PEATVGVSCCTLSMPNSVTRESRASSVSSVPVSI
Download sequence
Identical sequences M3WKJ7
ENSFCAP00000013315 XP_006931864.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]