SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000013995 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000013995
Domain Number 1 Region: 319-603
Classification Level Classification E-value
Superfamily Kelch motif 1.57e-61
Family Kelch motif 0.0000768
Further Details:      
 
Domain Number 2 Region: 52-167
Classification Level Classification E-value
Superfamily POZ domain 6.28e-31
Family BTB/POZ domain 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000013995   Gene: ENSFCAG00000015088   Transcript: ENSFCAT00000015092
Sequence length 621
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C2:86124074:86181400:1 gene:ENSFCAG00000015088 transcript:ENSFCAT00000015092 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLMAGQGGAWTMGDVVEKSLEGPLAPSTDEASQKRGDLVEILNGDKVKFDDTGLSLILQN
GLDTLRVENALTDVILCVDIQEFSCHRVVLAAASNYFRAMFCNDLKEKYEKRIIIKGVDA
ETMHTLLDYTYTSKALITKQNVQRVLEAANLFQFLRMVDACASFLTEALNPENCVGILRL
ADTHSLDSLKKQVQNYIIQNFVQILNSEEFLELPVDTLYHILKSDELYVTEEAQVFETVM
NWVRHKQAERLCLLPYLLENVRLPLLDPWYFVETVEADPLIRQCPEVFPLLQEARMYHLS
GNEIISERTKPRMHEFQSEVFMIIGGCTKDERFVAEVTCLDPLRRSRLEVAKLPMTEHEL
ESENKKWVEFACVTLKNEVYISGGKETQHDVWKYNSSINKWIQIEYLNIGRWRHKMVVLG
GKVYVIGGFDGLQRINNVETYDPFHNCWSEAAPLLVHVSSFAATSHKKKLYVIGGGPNGK
LATDKTQCYDPSTNKWNLKSSMPVEAKCINAVSFRDRIYVVGGAMRALYAYSPLEDSWCL
VTQLSHERASCGIAPCNNRLYITGGRDEKNEVIATVLCWDPEAQKLTEECVLPRGVSHHG
SVTIRKSYTHIRRIVPGAVSV
Download sequence
Identical sequences M3WLX0
ENSFCAP00000013995 XP_003991921.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]