SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014151 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014151
Domain Number 1 Region: 1355-1582
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 1.87e-39
Family Laminin G-like module 0.0028
Further Details:      
 
Domain Number 2 Region: 400-512
Classification Level Classification E-value
Superfamily Cadherin-like 5.14e-31
Family Cadherin 0.00084
Further Details:      
 
Domain Number 3 Region: 816-928
Classification Level Classification E-value
Superfamily Cadherin-like 1.41e-28
Family Cadherin 0.0007
Further Details:      
 
Domain Number 4 Region: 1605-1798
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.48e-28
Family Laminin G-like module 0.028
Further Details:      
 
Domain Number 5 Region: 505-610
Classification Level Classification E-value
Superfamily Cadherin-like 2.43e-27
Family Cadherin 0.0012
Further Details:      
 
Domain Number 6 Region: 290-398
Classification Level Classification E-value
Superfamily Cadherin-like 2.28e-26
Family Cadherin 0.0012
Further Details:      
 
Domain Number 7 Region: 916-1030
Classification Level Classification E-value
Superfamily Cadherin-like 6.85e-26
Family Cadherin 0.0013
Further Details:      
 
Domain Number 8 Region: 707-814
Classification Level Classification E-value
Superfamily Cadherin-like 8.42e-26
Family Cadherin 0.0018
Further Details:      
 
Domain Number 9 Region: 185-288
Classification Level Classification E-value
Superfamily Cadherin-like 1.1e-25
Family Cadherin 0.0017
Further Details:      
 
Domain Number 10 Region: 610-711
Classification Level Classification E-value
Superfamily Cadherin-like 8.71e-22
Family Cadherin 0.0014
Further Details:      
 
Domain Number 11 Region: 1024-1126
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000228
Family Cadherin 0.0079
Further Details:      
 
Domain Number 12 Region: 1282-1372,1569-1618
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000581
Family Growth factor receptor domain 0.016
Further Details:      
 
Domain Number 13 Region: 1931-1971
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000393
Family Laminin-type module 0.0094
Further Details:      
 
Domain Number 14 Region: 1837-1883
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000002
Family EGF-type module 0.0099
Further Details:      
 
Domain Number 15 Region: 1802-1836
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000326
Family EGF-type module 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014151   Gene: ENSFCAG00000015259   Transcript: ENSFCAT00000015263
Sequence length 2925
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:91968862:91991824:1 gene:ENSFCAG00000015259 transcript:ENSFCAT00000015263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSRAARAPLPTLLPPPPPPPPLLLLLLLLLLLPPLLGDQVGPCRSLGPGGRGSSGACAP
VGWLCPASASNLWLYTSRCRDAGTELTGHLVPHHDGLRVWCPESGAHIPLPPAPEGCPWS
CRLLGIGGHVSPQGKLTLPQEHPCLKAPRLRCQSCKLVQTPGLRAGERSAEESMGGRRKR
NVNTAPQFQPPSYQATVPENQPAGTPVASLRAIDPDEGEAGRLEYTMDALFDSRSKHFFS
LDPITGAVTTAEELDRETKSTHVFRVTAQDHGMPRRSALATLTILVTDTNDHDPVFEQQE
YKESLRENLEVGYEVLTVRATDGDAPPNANILYRLLEGPGGSPSEVFEIDPRSGVIRTRG
PVDREEVESYQLTVEASDQGRDPGPRSATAAVFLSVEDDNDNAPQFSEKRYVVQVREDVT
PGAPVLRVTASDRDKGSNALVHYSIMSGNARGQFYLDAQTGALDVVSPLDYETTKEYTLR
VRAQDGGRPPLSNVSGLVTVQVLDINDNAPIFVSTPFQATVLESVPLGYLVLHVQAIDAD
AGDNARLEYRLAGVGHDFPFAINNGTGWISVAAELDREEVDFYSFGVEARDHGTPVLTAS
ASVSVTILDVNDNNPTFTQPEYTVRLNEDAAVGTSVVTVSAVDRDAHSVITYQITSGNTR
NRFSITSQSGGGLVSLALPLDYKLERQYVLAVTASDGTRQDTAQVVVNVTDANTHRPVFQ
SSHYTVNVNEDRPAGTTVVLISATDEDTGENARITYFMEDSIPQFRIDADTGAVTTQAEL
DYEDQVSYTLAITARDNGIPQKSDTTYLEILVNDVNDNAPQFLRDSYQGSVYEDVPPFTS
VLQISATDRDSGLNGRVFYTFQGGDDGDGDFIVESTSGIVRTLRRLDRENVAQYILRAYA
VDKGMPPARTPMEVTVTVLDVNDNPPVFEQDEFDVFVEENSPIGLAVARVTATDPDEGTN
AQIMYQIVEGNIPEVFQLDIFSGELTALVDLDYEDRPEYILVIQATSAPLVSRATVHVRL
LDRNDNPPVLGNFEILFNNYVTNRSSSFPGGAIGRVPAHDPDISDSLTYSFERGNELSLV
LLNASTGELRLSRALDNNRPLEAIMSVLVSDGVHSVTAQCALRVTIITDEMLTHSITLRL
EDMSPERFLSPLLGLFIQAVAATLATPPDHVVVFNVQRDTDAPGGHILNVSLSVGQPPGP
GGGPPFLPSEDLQERLYLNRSLLTAISAQRVLPFDDNICLREPCENYMRCVSVLRFDSSA
PFIASSSVLFRPIHPVGGLRCRCPPGFTGDYCETEVDLCYSRPCGPHGRCRSREGGYTCL
CRDGYTGEHCEVSARSGRCTPGVCKNGGTCVNLLVGGFKCDCPSGDFEKPYCQVTTRSFP
ARSFITFRGLRQRFHFTLALSFATKERDGLLLYNGRFNEKHDFVALEVIQEQVQLTFSAG
ESTTTVSPFVPGGVSDGQWHTVQLKYYNKPLLGQTGLPQGPSEQKVAVVTVDGCDTGVAL
RFGAVLGNYSCAAQGTQGGSKKSLDLTGPLLLGGVPDLPESFPVRTRHFVGCMRNLQVDS
RHVDMADFIANNGTVPGCPAKKNVCDSNSCNNGGTCVNQWDAFSCECPLGFGGKSCAQEM
ANPQRFLGSSLVAWHGLSLPISQPWHLSLMFRTRQANGVLLQAVTRGRSTITLQLREGHV
VLSVEGTGLQASSLQLEPGRANDGDWHRAQLALGASGGPGHAILSLDYGQQRAEGNLGPR
LHGLHLSNITVGGVPGPAGGVARGFRGCLQGVRVSETPEGVSGLDPGRGESINVEPGCSL
PDPCDSNPCPANSYCSDDWDSYSCSCDPGYYGDNCTNVCDLNPCEHQSVCIRKPSAPHGY
TCECPPNYLGPYCETRIDQPCPRGWWGHPTCGPCNCDVSKGFDPDCNKTSGECHCKENHY
RPPGSPTCLLCDCYPTGSLSRVCDPEDGQCPCKPGVIGRQCDRCDNPFAEVTTNGCEVNY
DSCPRAIEAGIWWPRTRFGLPAAAPCPKGSFGTAVRHCDEHRGWLPPNLFNCTSVTFSEL
KGFAERLQRNESGLDSGRSQRLALLLRNATQHTAGYFGSDVKVAYQLATRLLAHESAQRG
FGLSATQDVHFTENLLRVGSALLDAANKRHWELIQQTEGGTAWLLQHYEAYASALAQNMR
HTYLSPFTIVTPNIVISVVRLDKGNFAGAKLPRYEALRGERPPDLETTVILPDSVFRETP
TVVRPAGPGETQEPEELARRQRRHPELSQGEAVASVIIYRTLAGLLPHNYDPDKRSLRVP
KRPVINTPVVSISVHDDEELLPRALDKPVTVQFRLLETEERTKPICVFWNHSILVSGTGG
WSARGCEVVFRNESHVSCQCNHMTSFAVLMDVSRRENGEILPLKTLTYVALGVTLAALLL
AFLFLTILRALRSNQHGIRRNLTAALGLAQLVFLLGINQADLPFACTVIAILLHFLYLCT
FSWALLEALHLYRALTEVRDVNAGPMRFYYMLGWGVPAFITGLAVGLDPEGYGNPDFCWL
SIYDTLIWSFAGPVAFAVSMSVFLYILAARASCAAQRQGFEKKGPVSGLRPSFAVLLLLS
ATWLLALLSVNSDTLLFHYLFAACNCIQGPFIFLSYVVLSKEVRKALKFACSRKPSPDPA
LTTKSTLTSSYNCPSPYADGRLYQPYGDSAGSLHSASRSGKSQPSYIPFLLREESTLNPG
QGPPGLGDPGSLFLEGQDQQHDPDTDSDSDLSLEDDQSGSYASTHSSDSEEEEEEEEEEA
AFPGEPGWDSLLGPGAERLPLHSTPKDGGPGSGKAPWPGDFGTTAKESSGNGASEEHPWE
NGDXSLGPLPGPSAQPHKGILKKKYLPTISEKSSLLRLPLEQGTGSSRGSSASEGSRGGP
PPRPPPRQSLQEQLNGVMPIAMSIKAGTVDEDSSGSEFLFFNFLH
Download sequence
Identical sequences ENSFCAP00000014151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]