SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000014512 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000014512
Domain Number 1 Region: 26-62
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000000668
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 2 Region: 66-104
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000458
Family LDL receptor-like module 0.0017
Further Details:      
 
Domain Number 3 Region: 102-131
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000236
Family LDL receptor-like module 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000014512   Gene: ENSFCAG00000015648   Transcript: ENSFCAT00000015652
Sequence length 155
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:91676511:91732745:1 gene:ENSFCAG00000015648 transcript:ENSFCAT00000015652 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ACLMSPSPLSSAESQLLPGNNFTNECNIPGNFMCSNGRCIPGAWQCDGLPDCFDKSDEKE
CPKAKSKCGPTFFPCASGIHCIIGRFQCNGFEDCPDGSDEENCMNNGLCIDKSFICDGQN
NCQDNSDEESCESSQGRKPLCLVALVRMLLTLMHL
Download sequence
Identical sequences ENSFCAP00000014512

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]