SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015382 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015382
Domain Number 1 Region: 36-149
Classification Level Classification E-value
Superfamily PH domain-like 2e-38
Family Enabled/VASP homology 1 domain (EVH1 domain) 0.0000417
Further Details:      
 
Domain Number 2 Region: 242-371
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 1.31e-29
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0000129
Further Details:      
 
Domain Number 3 Region: 429-490
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00000000000209
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015382   Gene: ENSFCAG00000018126   Transcript: ENSFCAT00000019237
Sequence length 502
Comment pep:known_by_projection chromosome:Felis_catus_6.2:X:41766906:41773609:1 gene:ENSFCAG00000018126 transcript:ENSFCAT00000019237 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TMSGGPVGGRSGGRGGPGVQQNVPSTLLQDHENQRLFEMLGRKCWTLATAVVQLYLALPP
GAEHWTKEHCGAVCFVKDNPQKSYFIRLYGLQAGQLLWEQELYSQLVYSTPTPYFHTFAG
DDCQAGLNFADEGEAQAFRALVQEKIQKRNQRQSGDRRQLPPPPAPANEERRGPPPLPPH
PGGDQGGPAAGPLSLGLVTVDIQNPDITSSRYRGLPAPGPGPADKKRSGKKKISKADIGA
PSGFKHVSHVGWDPQNGFDVNNLDPDLRSLFSRAGISEAQLTDAETSKLIYDFIEDQGGL
EAVRQEMRRQEPLPPPPPPSRGGNQPPRPPTIGSNKGRSGPLPPVPLGGAPPPPTPRGPP
PPGRGGPPPPPPPATGRSGPPPPPPSGPGGTPVPPPPPPPPPPPPSSDDGPVPPPPPALG
PVGGLAPSGGRGALLDQIRQGIQLNKTPGAPESSALQPPPPRSEGLVGALMHVMQKRSRA
IHSSDEGEDQAGDEDEDDEWDD
Download sequence
Identical sequences ENSFCAP00000015382

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]