SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000015628 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000015628
Domain Number 1 Region: 853-911
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000017
Family TSP-1 type 1 repeat 0.0036
Further Details:      
 
Domain Number 2 Region: 623-689
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000798
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 3 Region: 744-798
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000123
Family TSP-1 type 1 repeat 0.0073
Further Details:      
 
Domain Number 4 Region: 48-105
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000017
Family TSP-1 type 1 repeat 0.0013
Further Details:      
 
Domain Number 5 Region: 798-858
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000419
Family TSP-1 type 1 repeat 0.0032
Further Details:      
 
Domain Number 6 Region: 566-626
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000131
Family TSP-1 type 1 repeat 0.0088
Further Details:      
 
Domain Number 7 Region: 691-741
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000746
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000015628   Gene: ENSFCAG00000019127   Transcript: ENSFCAT00000019367
Sequence length 955
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D4:93882299:93915458:-1 gene:ENSFCAG00000019127 transcript:ENSFCAT00000019367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGGRRQPSRWVWSLLAVALLAGRVASTGATDHSPTSNSLEGGSDATAYWWGEWTKWTACS
RSCGAGVTSQERHCLQQRRTSVTGAGNRTCTGTSKRYQLCRLQECPPDGRSFREEQCISF
NSRVYDGRTHQWKPLYPDDYVHISSKPCDLHCTTVDGQRQLMVPARDGTSCKLTDLRGVC
VSGKCEPIGCDGVLFSTHTLDKCGVCQGDGSSCTHVTGNYRKGNAHLGYSLVTHIPAGAR
DIQIVERKKSADVLALADEAGFYFFNGNFKVDSPKNFNIAGTVVKYRRPMDVYETGIEYI
VAQGPTNQGLNVMVWNQNGRSPSITFEYTLLQPPHAHRTQPVYYSFSEPASESAESQELD
GAALLGFLRHNSSFYGQASSERLGLDNRLFGHLGPGIELGLSKGRETNEVCEQASGRACE
GPPRGKGFRDGNATGTALAGDKDDPEVDARLPSQQLLSANAISDRLLGTGSDSRELPFND
TGNSIFVQGVPRSSPADSLYVDYEDGERAGTHLLNGSYLELSSDRVTNTSSEAPFPNASA
SLPAVAGNRTHKARTRPKARKQGVSPADMYRWKLSSHEPCSATCTTGVMSTYAMCVRYDG
IEVDDSYCDALTRPEPVQEFCAGRECQPRWETSSWSECSRTCGEGYQFRIVRCWKMLSPG
FDSSVYSDLCEAAEAVRPEERKTCRNPACGPQWEMSEWSECTAKCGERSVVTRDIRCSED
EKLCDPNTRPVGEKDCTGPPCDRQWTVSDWGPCSGSCGQGRMIRHVYCKTSDGRVVPESQ
CQMESKPLAIHPCGDKNCPAHWLAQDWERCNTTCGRGVKKRLVLCMELANGRPQTRSGPE
CGLAKKPPEESTCFERPCFKWYTSPWSECTKTCGVGVRMRDVKCYQGTDIVRGCDPLVKP
VGRQACDLLPCPTEPPDDSCQDQPGTNCALAIKVNLCGHWYYSMACCRSCRPPRS
Download sequence
Identical sequences M3WNU5
XP_006939683.1.62641 ENSFCAP00000015628

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]