SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016373 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016373
Domain Number 1 Region: 7-102,133-241
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 6.06e-67
Family Calponin-homology domain, CH-domain 0.0000815
Further Details:      
 
Domain Number 2 Region: 505-577
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000151
Family Spectrin repeat 0.022
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000016373
Domain Number - Region: 329-411
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0832
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016373   Gene: ENSFCAG00000022055   Transcript: ENSFCAT00000022079
Sequence length 577
Comment pep:novel chromosome:Felis_catus_6.2:B2:139363317:139425309:-1 gene:ENSFCAG00000022055 transcript:ENSFCAT00000022079 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAKRKPPLVVDDLFEDMKDGVKLLALLEVLSGQKLPCEQGRRMKRIHAVANIGTALKFLE
GRKIKLVNINSTDIADGRPSIVLGLMWTIILYFQIEELTSNLPQLQSLPGSTSSVDSMVS
AETASPPSKRKVATKIQGNAKKALLKWVQYTVAKLRQTGIDVKDFGRSWRSGVAFHSVIH
AIRPELVDLEKVKGRSNRENLEEAFTIAESELGIPRLLDPEDVDVDKPDEKSIMTYVAQF
LKHYPDIHNTGTDGQENDREDGLILKETKVWIEQFERDLTRAQMTESNLQDKYQSFKHFR
VQYEIKRKQIEHLIQPVHRDGKLSLDQALVKQSWDRVSSRLFDWHIQLDKSLPAPLGTIG
AWLYRAEVALREEITIQQVHEETANTIQRKREQHKDLLQNTDAHKRAFHEIYRTRSVNGI
PVPPDQLEDMAERFHFVSSTSELHLMKMEFLELKYRLLSLLVLAESKLKSWIIKYGRRES
VELLLQNYISFIENSKFFEQYEVTYQILKQTAEMYVKADGSVEEAENVMKFMNETTAQWR
NLSVEVRSVRSMLEEVIANWDRYGNTVASLQAWLEDA
Download sequence
Identical sequences ENSFCAP00000016373

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]