SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000016723 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000016723
Domain Number 1 Region: 2-91
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000366
Family Spectrin repeat 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000016723   Gene: ENSFCAG00000025009   Transcript: ENSFCAT00000026094
Sequence length 102
Comment pep:novel chromosome:Felis_catus_6.2:X:27652978:27689723:-1 gene:ENSFCAG00000025009 transcript:ENSFCAT00000026094 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNLLNSRWECLRVASMEKQSNLHKVLMDLQNQQLKELNDWLTKTEERTRKMEKEPLGPDI
EDLKRQVQQHKVLQEDLEQEQVRVNSLTHMVVVVDESGGDQA
Download sequence
Identical sequences ENSFCAP00000016723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]