SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017190 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017190
Domain Number 1 Region: 1-217
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 3.9e-80
Family Calponin-homology domain, CH-domain 0.0000238
Further Details:      
 
Domain Number 2 Region: 235-357
Classification Level Classification E-value
Superfamily Spectrin repeat 2.24e-33
Family Spectrin repeat 0.000000295
Further Details:      
 
Domain Number 3 Region: 471-592
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-31
Family Spectrin repeat 0.000000556
Further Details:      
 
Domain Number 4 Region: 358-466
Classification Level Classification E-value
Superfamily Spectrin repeat 2.36e-23
Family Spectrin repeat 0.000000911
Further Details:      
 
Domain Number 5 Region: 596-707
Classification Level Classification E-value
Superfamily Spectrin repeat 1.22e-22
Family Spectrin repeat 0.000000588
Further Details:      
 
Domain Number 6 Region: 700-803
Classification Level Classification E-value
Superfamily EF-hand 1.51e-19
Family Calmodulin-like 0.0044
Further Details:      
 
Domain Number 7 Region: 843-896
Classification Level Classification E-value
Superfamily EF-hand 0.00000000195
Family EF-hand modules in multidomain proteins 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017190   Gene: ENSFCAG00000004445   Transcript: ENSFCAT00000026246
Sequence length 897
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D2:11929576:11974982:-1 gene:ENSFCAG00000004445 transcript:ENSFCAT00000026246 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTFTAWCNSHLRKAGTQIENIEEDFRNGLKLMLLLEVISGERLPKPDRGKMRFHKIANVN
KALDYIASKGVKLVSIGAEAKEIVDGNVKMTLGMIWTIILRFAIQDISVEETSAKEGLLL
WCQRKTAPYRNVNIQNFHTSWKDGLGLCALIHRHRPDLIDYSKLNKDDPIGNINLAMEIA
EKHLDIPKMLDAEDLVYTARPDERAIMTYVSCYYHAFAGAQKAETAANRICKVLAVNQEN
ERLMEEYERLASELLEWIRRTIPWLENRTPEKAMHAMQQKLEDFRDYRRKHKPPKVQEKC
QLEINFNTLQTKLRISNRPAFMPSEGKMVSDIAGAWQRLEQAEKGYEEWLLNEIRRLERV
EHLAEKFKQKASTHETWAYGKEQILLQKDYESATLTEVRAMLRKHEAFESDLAAHQDRVE
QIAAIAQELNELDYHDAVNVNDRCQKICDQWDRLGTLTQKRREALERTEKLLETIDQLHL
EFAKRAAPFNNWMEGAMEDLQDMFIVHSIEEIQSLITAHEQFKATLPEADGERQSIMAIQ
NEVEKVIQSYSIRISSSNPYSTVTVDELRAKWDKVKQLVPIRDQSLQEELARQHANERLR
RQFAAQANAIGPWIQNKMEEIARSSIQITGALEDQMNQLKQYEHNIINYKNNIDKLEGDH
QLIQEALVFDNKHTNYTMEHIRVGWEVLLTTIARTINEVETQILTRDAKGITQEQMNEFR
ASFNHFDRRKNGLMDHEDFRACLISMGYDLGEAEFARIMTLVDPNGQGTVTFQSFIDFMT
RETADTDTAEQVIASFRILASDKLHWLNAISHSGSVDAPQIRYRGTGNLFLRISDLNFVP
NHGSKPYILAEELRRELPPDQAQYCIKRMPAYSGPGSVPGALDYTAFSSALYGESDL
Download sequence
Identical sequences ENSFCAP00000017190

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]