SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017324 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017324
Domain Number 1 Region: 346-618
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.34e-86
Family Eukaryotic proteases 0.00000000119
Further Details:      
 
Domain Number 2 Region: 106-197
Classification Level Classification E-value
Superfamily Kringle-like 3.62e-32
Family Kringle modules 0.00000729
Further Details:      
 
Domain Number 3 Region: 211-296
Classification Level Classification E-value
Superfamily Kringle-like 5.32e-27
Family Kringle modules 0.0000176
Further Details:      
 
Domain Number 4 Region: 45-104
Classification Level Classification E-value
Superfamily GLA-domain 9.08e-19
Family GLA-domain 0.0000672
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017324   Gene: ENSFCAG00000029088   Transcript: ENSFCAT00000031850
Sequence length 622
Comment pep:known_by_projection chromosome:Felis_catus_6.2:D1:100733461:100749895:1 gene:ENSFCAG00000029088 transcript:ENSFCAT00000031850 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAHIRGLWLPGCLALAALCSLVHSQHVFLAPQQALSLLQRVRRANSGFLEEVRKGNLERE
CVEELCSYEEAFEALESSFATDVFWAKYTACESVRKPRDKLMECLEGNCAEGLGMNYRGN
VNFTRSGIECQLWRSRYPHKPEINYTTHPGADLKENFCRNPDGSTTGPWCYTTDPTVRRE
ECSIPICGQGGVTVQPTPRSRNSTVNLPPPSDSCIPERGRYYHGRLAVTTHGSPCLAWDS
SQAKALSENQDFNPLVPLEKNFCRNPDGDEEGVWCYVSGGPGDFEYCNLDYCEEPFEDVS
DGLAEDPEAPIEGRTTAEEFQTFFNEKTFGAGEADCGLRPLFEKKSLKDKTEEELLDSYI
DGRIVKGWDAEIGIAPWQVMLFRKSPQELLCGASLISDRWVLTAAHCLLYPPWDKNFTEN
DLLVRIGKHSRTRYERSIEKISMLEKIYIHPRYNWRENLDRDIALLKLKKPIAFSSYIHP
VCLPDKATVARLIQTGYKGRVTGWGNLKETWTTSVGEVQPSVLQVVNLPLVEQPVCRAST
RIRITDNMFCAGYKPNEGKRGDACEGDSGGPFVMKSPFNNRWYQMGIVSWGEGCDRDGKY
GFYTHVFRLKKWIRKVIDQSGS
Download sequence
Identical sequences M3WSI8
XP_003993267.1.62641 ENSFCAP00000017324

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]