SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017657 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017657
Domain Number 1 Region: 6-123,187-302
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 7.1e-49
Family Adenylyltransferase 0.00001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017657   Gene: ENSFCAG00000022804   Transcript: ENSFCAT00000022217
Sequence length 307
Comment pep:known_by_projection chromosome:Felis_catus_6.2:F1:24463926:24609790:1 gene:ENSFCAG00000022804 transcript:ENSFCAT00000022217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTETTKTHVILLACGSFNPITKGHIQMFERARDYLHKTGRFIVIGGIVSPVHDSYGKQGL
VSSRHRLIMCQLAVQNSDWIRVDPWECYQDTWQTTCSVLEHHRDLMKRVTGCILSNVNTP
SMTPVIGQPQNETPQPIYQNSNVSTKPTAAKILGKVGESLSRICCVRPPVERFTFVDENA
NLGTVMRYEEIELRILLLCGSDLLESFCIPGLWNEADMEVIVGDFGIVVVPRDAADTDRI
MNHSSILRKYKNNIMVVKDDINHPMSVVSSTKSRLALQHGDGHVVDYLSQPVIDYILKSQ
LYINASG
Download sequence
Identical sequences A0A2I2V4G1 J9NZG3
ENSCAFP00000038683 XP_010638851.1.5607 XP_011289298.1.62641 XP_013970600.1.84170 XP_013970601.1.84170 XP_019282957.1.44245 ENSFCAP00000017657 ENSCAFP00000038683

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]