SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017798 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017798
Domain Number 1 Region: 106-311
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.11e-48
Family DBL homology domain (DH-domain) 0.000000458
Further Details:      
 
Domain Number 2 Region: 298-460
Classification Level Classification E-value
Superfamily PH domain-like 1.01e-32
Family Pleckstrin-homology domain (PH domain) 0.0047
Further Details:      
 
Domain Number 3 Region: 587-688,737-763
Classification Level Classification E-value
Superfamily SH2 domain 2.59e-27
Family SH2 domain 0.00051
Further Details:      
 
Domain Number 4 Region: 508-618
Classification Level Classification E-value
Superfamily SH3-domain 0.000000000000538
Family SH3-domain 0.0021
Further Details:      
 
Domain Number 5 Region: 703-752
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000129
Family SH3-domain 0.002
Further Details:      
 
Domain Number 6 Region: 7-143
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000689
Family Calponin-homology domain, CH-domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017798   Gene: ENSFCAG00000001191   Transcript: ENSFCAT00000031950
Sequence length 767
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:90572484:90762792:-1 gene:ENSFCAG00000001191 transcript:ENSFCAT00000031950 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CKIIFEKNSYLSQSTCLINAFLFSQVIETLSRLSRTPIALATGIRPFPTEESVNDEDIYK
GLPDLIDETHVEDEEGLYDCVYGEDEGGEVYEDLMKAEEAHQAKCPENDIRSCCLAEIKQ
TEEKYTETLESIEKYFMAPLKRFLTAAEFDSVFINIPELVKVHRNLMQEIHDSIVNKNDQ
NLYQVFIICDYSEGLVIYGQYCSGVELAISSLDNISKTKEDVKLKLEECSKRANNGKFTL
RDLLVVPMQRVLKYHLLLQELVKHTTDPMEKANLKLALDAMKDLAQYVNEVKRDNETLRE
IKQFQLSIENLNQPVLLFGRPQGDGEIRITTLDKHTKQERHIFLFDLAVIVCKRKGDNYE
MKEIIDLQQYKIANNPTTDKENKKWSYGFYLIHTQGQNGLEFYCKTKDLKKKWLEQFEMA
LSNIRPDYADSNFHEFKMHTFSRVTSCKVCQMLLRGTFYQGYLCFKCGARAHKECLGRVD
NCGRVNSAEQGTLKPPEKRTNGLRRNPRQVDPGLPKMQVIKNYTGTPPPALHEGPPLHIQ
AGDTVELLRGDAHSLFWQGNNLASGEVGFFPSDAVKPCPCVPKPVDYSCQPWYAGAMERL
QAETELINRVNSTYLVRHRTKESGEYAISIKYNNEAKHIKILTRDGFFHIAENRKFKSLM
ELVEYYKHHSLKEGFRTLDTTLQFPYKEPEHSAGQRGNRAGHSLLSPKVLGIAVARYDFC
ARDMRELSLLKGDVVKIYTKMSANGWWRGEVNGRVGWFPSTYVEEDE
Download sequence
Identical sequences ENSFCAP00000017798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]