SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000017964 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000017964
Domain Number 1 Region: 3-89
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000127
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000017964   Gene: ENSFCAG00000023125   Transcript: ENSFCAT00000023887
Sequence length 91
Comment pep:novel chromosome:Felis_catus_6.2:X:27430294:27443623:-1 gene:ENSFCAG00000023125 transcript:ENSFCAT00000023887 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRKEMNALTEWLAATDMELTKRSAVEGMPSNLDSEVAWGKATQKEIEKQKVHLKSVTELG
EALKTVLGKKEALVEDKLSLLNSNWIAVTSR
Download sequence
Identical sequences ENSFCAP00000017964

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]