SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018392 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018392
Domain Number 1 Region: 1719-1771
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000108
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 2 Region: 1679-1734
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000297
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 3 Region: 1626-1674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000598
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 599-651
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000255
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 5 Region: 640-691
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000341
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 6 Region: 1358-1410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000998
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 7 Region: 1582-1640
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000149
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 8 Region: 361-410
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000153
Family Classic zinc finger, C2H2 0.033
Further Details:      
 
Domain Number 9 Region: 1751-1805
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000231
Family Classic zinc finger, C2H2 0.028
Further Details:      
 
Domain Number 10 Region: 400-462
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000513
Family Plant C2H2 finger (QALGGH zinc finger) 0.093
Further Details:      
 
Domain Number 11 Region: 102-125,159-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000569
Family Classic zinc finger, C2H2 0.076
Further Details:      
 
Domain Number 12 Region: 1039-1090
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000132
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 13 Region: 1421-1469
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000046
Family Classic zinc finger, C2H2 0.038
Further Details:      
 
Weak hits

Sequence:  ENSFCAP00000018392
Domain Number - Region: 1491-1538
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00264
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number - Region: 743-793
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00313
Family Classic zinc finger, C2H2 0.049
Further Details:      
 
Domain Number - Region: 1334-1367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00559
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 682-718
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00613
Family Classic zinc finger, C2H2 0.025
Further Details:      
 
Domain Number - Region: 543-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0622
Family Classic zinc finger, C2H2 0.034
Further Details:      
 
Domain Number - Region: 1269-1289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0637
Family Classic zinc finger, C2H2 0.04
Further Details:      
 
Domain Number - Region: 462-521
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0769
Family Plant C2H2 finger (QALGGH zinc finger) 0.093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018392   Gene: ENSFCAG00000024599   Transcript: ENSFCAT00000025256
Sequence length 1847
Comment pep:known_by_projection chromosome:Felis_catus_6.2:C1:202484514:202503928:-1 gene:ENSFCAG00000024599 transcript:ENSFCAT00000025256 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTDPVLDPQPTDNTGEMDGLCPELLLIPPSLSNRGILEPVQSPCPAGNPTPLPADPGCLL
VESTATEEDTGNMEIIVEAVAGNLSPGAPGEPPGVLVKVVEVYFCERCEQSFAEPTLLAL
HQCTETLIQPMQGLSSLPCSVELTPSNLILSGPLQGQGPPDSPLPCPVCRQEFAQPQALK
SHFKIHRATPDIFSCPESGCVFSAEDRKGLQHHLRQAHATVPVPCSFRGCPLLFGSQQGM
ELHRQAHYPFHCNHCSFVGSNVKLFRQHQRSHGAGTQGELSALQGLPSQELLPAPKLPSR
EGEPSEQADTPLPRRESADEEDVEEEEGNGTLKDSQKAPEKAQGAQQLEGDVASGTESLF
KTHMCPECKRCFKKRTHLVEHLHLHFPDPSLQCPNCQKFFTSKSKLKTHLLRELGQKAHR
CPLCHYSAVERNALNRHMASMHEDISNFYSDTYTCPVCREEFRLSQALKEHLKSHTAAAA
AEPLPLRCFQEGCGYTAPDRKAFIKHLKETHGVRAVECRHHSCPMLFATAEAMEAHHKSH
YAFHCPHCDFACSNKHLFRKHKKQGHPGSEELRCTFCPFATFNPVAYQDHVGKMHAHEKI
HQCPECSFATAHKRVLIRHMLLHTGEKPHKCELCDFTCRDVSYLSKHMLTHSNTKDYMCT
ECGYVTKWKHYLSVHMRKHAGDLRYQCNQCSYRCHRADQLSSHKLRHQGKSLMCEVCAFA
CKRKYELQKHMASQHHPGAPAPLYPCRYCSYQSRHKQALLSHENCKHTRLREFRCALCDY
RTFSNTTLFFHKRKAHGYVPGDQVWQLRSASQEPEGARQCPTPPPDSEPSSQLSPQPEAP
DRDPGTVVDPNVDRAPPEPGEEDRAGRPAGSEVPRGDDLGSSPSPAEADEGGCTLHLEAL
GVELEPVAEPPLEEITEPAPAEFRPLDPSGPLRLEGPDATLTELSTFEGAGTSGLDAEEE
PVLEKPAPESPRNPPSSEEPPDSWVGTFKAALPAETAPLPQFPESESLLKALRRQDKEQA
EALVLEGRVQMVVIQGEGRAFRCPHCPFITRREKALSVHSRTGCQGRREPLLCPECGASF
KQQRGLSTHLLKKCPVLLRKNKGLPRPSSPVPLCPPPPGTQDSGDVEGGKPPPAPLEVEL
VLPKDAPSVPPREPEVEEPPGTLCVPTVPPAGNPSPAETPEKFHFEQGKFHCNSCTFLCS
RLSSITSHVAEGCRGGRGGGGKRGAAQTQPVASVLSDGGSAPLNSGSTERSPGNGDTTAV
PKQKGARFSCPTCPFSCQQERALRTHQTRGCPLEGSGELHCGLCTFTTAAAAALRLHQKR
RHPSTAPARGPRPPLQCGDCGFTCKQGRCLQQHRRLKHEGVKPHQCPFCDFSTTRRYRLE
AHQSRHTGVGRIPCSSCPQTFGTNSKLRLHRLRVHDKTPTHFCPLCDYSGYLRHDITRHV
NSCHRGTPAFACPRCEAQFSSETALKQHALRRHPEPAPPAPGSPAEATEGPLHCSRCGLL
CPSPASLRGHTRKQHPRLECGACQEAFPSRPALDEHRRQQHFSHRCQLCDFAARERAGLV
KHYLEQHEAAAASEGGAGASQPPLRCPFCDFTCRHQLVLDHHVKGHGGTRLYKCTDCAYS
TKNRQKITWHSRIHTGEKPYRCHLCPYACADPSRLKYHMRIHKEERKYLCPDCGYKCKWV
NQLKYHMTKHTGLKPYQCPECEYCTNRADALRVHQETRHREARAFMCEQCGKAFKTRFLL
RTHLRKHSEAKPYVCNVCHRAFRWAAGLRHHALTHTDRHPFFCRLCSYKAKQKFQVVKHV
RRHHPDQADPNQGVGKDPTTPTVHLHDVQLEDPSPPAPAAPPTGPEG
Download sequence
Identical sequences ENSFCAP00000018392 XP_019694234.1.62641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]