SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSFCAP00000018469 from Felis catus 76_6.2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSFCAP00000018469
Domain Number 1 Region: 277-422
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000144
Family Spectrin repeat 0.0099
Further Details:      
 
Domain Number 2 Region: 177-302
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000137
Family Spectrin repeat 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSFCAP00000018469   Gene: ENSFCAG00000027593   Transcript: ENSFCAT00000026641
Sequence length 546
Comment pep:novel chromosome:Felis_catus_6.2:B3:111965884:111978004:1 gene:ENSFCAG00000027593 transcript:ENSFCAT00000026641 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDPREIQADSWRKRRESEEPSSPQSLCHLVPPAPGPERSGCETPVSVDSIPLEWDHTGD
VGGSSSHEDDEEGPYYSALSDVEIPENPEAYLKMTTKTLKASSGKSISEDHSWHVPDSPS
CPKHRYKQMGSDRNVQTIPSDSSTPYKPAYVKLLLSPGTDGGKEGARALNGSSQQEDEGL
AALTGQQSGAFDRWELIQAQELHNQLRMKQNLQQLNSKISDITTWLKKTEAELEMLKMAE
PPSDIHEMELRVKQLKEILKAFDTYKALVVSVNMSSEEFLQTESAESKELQGRVGQLALH
WDAAQGAVESWRAGLRRALVQCQDFHQLSQDLLLWLASAESRRQKAHVTDPEADPQVLLE
CQEELMQLKKELVEREPQVNTLQELSNSLLIKGHGEDYIEAEEKVHVIEKKLKQLLEQVS
QDLMSLQGSQNPDPSLPSLDEVDSGDEPPAASTPAPQAKQFGAERMTKDQNKADSRVPGP
GSSRPRRSFLARVIRAALPLQLLLLLLLLLACLLPSSEEDYSCTQANNFARSFYPMLRYT
NGPPPT
Download sequence
Identical sequences ENSFCAP00000018469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]